SLC25A24 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP160063-Each-of-1 | In Stock | ₹ 41,710.50 |
NBP160063 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
Antigen
SLC25A24
Classification
Polyclonal
Conjugate
Unconjugated
Formulation
PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Symbols
SLC25A24
Immunogen
Synthetic peptides corresponding to SLC25A24(solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24) The peptide sequence was selected from the middle region of SLC25A24. Peptide sequence FLFNPVTDIEEIIRFWKHSTGIDIGDSLTIPDEFTEDEKKSGQWWRQLLA The peptide sequence for this immunogen was taken from within the described region.
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Expected identity based on immunogen sequence: Canine: 100%; Guinea pig: 100%; Equine: 100%; Rat: 100%; Chicken: 85%.
Target Species
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Form
Purified
Applications
Western Blot
Concentration
1 mg/ml
Dilution
Western Blot 1.0 ug/ml
Gene Alias
APC1calcium-binding mitochondrial carrier protein SCaMC-1, calcium-binding transporter, DKFZp586G0123, MCSC1, Mitochondrial ATP-Mg/Pi carrier protein 1, mitochondrial ATP-Mg/Pi transporter, Mitochondrial Ca(2+)-dependent solute carrier protein 1, SCAMC1, SCAMC-1, short calcium-binding mitochondrial carrier 1, Small calcium-binding mitochondrial carrier protein 1, solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24, Solute carrier family 25 member 24
Host Species
Rabbit
Purification Method
Protein A purified
Regulatory Status
RUO
Gene ID (Entrez)
29957
Reconstitution
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype
IgG
Related Products
Description
- SLC25A24 Polyclonal specifically detects SLC25A24 in Human samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: SLC25A24
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Symbols: SLC25A24
Immunogen: Synthetic peptides corresponding to SLC25A24(solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24) The peptide sequence was selected from the middle region of SLC25A24. Peptide sequence FLFNPVTDIEEIIRFWKHSTGIDIGDSLTIPDEFTEDEKKSGQWWRQLLA The peptide sequence for this immunogen was taken from within the described region.
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Guinea pig: 100%; Equine: 100%; Rat: 100%; Chicken: 85%.
Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Form: Purified
Applications: Western Blot
Concentration: 1 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Alias: APC1calcium-binding mitochondrial carrier protein SCaMC-1, calcium-binding transporter, DKFZp586G0123, MCSC1, Mitochondrial ATP-Mg/Pi carrier protein 1, mitochondrial ATP-Mg/Pi transporter, Mitochondrial Ca(2+)-dependent solute carrier protein 1, SCAMC1, SCAMC-1, short calcium-binding mitochondrial carrier 1, Small calcium-binding mitochondrial carrier protein 1, solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24, Solute carrier family 25 member 24
Host Species: Rabbit
Purification Method: Protein A purified
Regulatory Status: RUO
Gene ID (Entrez): 29957
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype: IgG
Antigen: Protocadherin-15
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Symbols: PCDH15
Immunogen: Synthetic peptides corresponding to PCDH15(protocadherin 15) The peptide sequence was selected from the N terminal of PCDH15. Peptide sequence HSIVVQVQCINKKVGTIIYHEVRIVVRDRNDNSPTFKHESYYATVNELTP.
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: __
Target Species: Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit
Form: __
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Alias: autosomal recessive 23, cadherin-related family member 15, DKFZp667A1711, protocadherin-15, protocadherin-related 15
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 65217
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype: IgG
Antigen: TC-PTP/PTPN2
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Symbols: PTPN2
Immunogen: Synthetic peptides corresponding to PTPN2(protein tyrosine phosphatase, non-receptor type 2) The peptide sequence was selected from the middle region of PTPN2. Peptide sequence ESGSLNPDHGPAVIHCSAGIGRSGTFSLVDTCLVLMEKGDDINIKQVLLN.
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Xenopus: 100%; Bovine: 100%; Chicken: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%.
Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Form: __
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Gene Alias: protein tyrosine phosphatase, non-receptor type 2, PTPTPTN2, T-cell protein tyrosine phosphatase, T-cell protein-tyrosine phosphatase, TCELLPTP, TC-PTP, TCPTPEC 3.1.3.48, tyrosine-protein phosphatase non-receptor type 2
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 5771
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype: IgG
