SLC38A3 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP160103-Each-of-1 | In Stock | ₹ 42,737.22 |
NBP160103 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 42,737.22
GST (18%): ₹ 7,692.70
Total Price: ₹ 50,429.92
Antigen
SLC38A3
Classification
Polyclonal
Conjugate
Unconjugated
Formulation
PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias
G17sodium-coupled neutral amino acid transporter 3, Na(+)-coupled neutral amino acid transporter 3, NAT1, N-system amino acid transporter 1, SN1system N1 Na+ and H+-coupled glutamine transporter, SNAT3, Solute carrier family 38 member 3, solute carrier family 38, member 3, System N amino acid transporter 1
Host Species
Rabbit
Molecular Weight of Antigen
56 kDa
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Expected identity based on immunogen sequence: Bovine: 100%; Equine: 100%; Pig: 100%; Rabbit: 100%; Canine: 92%; Guinea pig: 85%.
Target Species
Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep
Isotype
IgG
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Concentration
0.5 mg/ml
Dilution
Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
Gene Accession No.
Q99624
Gene Symbols
SLC38A3
Immunogen
Synthetic peptides corresponding to SLC38A3(solute carrier family 38, member 3) The peptide sequence was selected from the N terminal of SLC38A3. Peptide sequence GNQRVEDPARSCMEGKSFLQKSPSKEPHFTDFEGKTSFGMSVFNLSNAIM.
Purification Method
Affinity purified
Regulatory Status
RUO
Gene ID (Entrez)
10991
Reconstitution
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Description
- SLC38A3 Polyclonal specifically detects SLC38A3 in Human, Mouse samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).
Compare Similar Items
Show Difference
Antigen: SLC38A3
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: G17sodium-coupled neutral amino acid transporter 3, Na(+)-coupled neutral amino acid transporter 3, NAT1, N-system amino acid transporter 1, SN1system N1 Na+ and H+-coupled glutamine transporter, SNAT3, Solute carrier family 38 member 3, solute carrier family 38, member 3, System N amino acid transporter 1
Host Species: Rabbit
Molecular Weight of Antigen: 56 kDa
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Equine: 100%; Pig: 100%; Rabbit: 100%; Canine: 92%; Guinea pig: 85%.
Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
Gene Accession No.: Q99624
Gene Symbols: SLC38A3
Immunogen: Synthetic peptides corresponding to SLC38A3(solute carrier family 38, member 3) The peptide sequence was selected from the N terminal of SLC38A3. Peptide sequence GNQRVEDPARSCMEGKSFLQKSPSKEPHFTDFEGKTSFGMSVFNLSNAIM.
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 10991
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Antigen: SLC38A3
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS & 2% Sucrose. with No Preservative
Gene Alias: G17sodium-coupled neutral amino acid transporter 3, Na(+)-coupled neutral amino acid transporter 3, NAT1, N-system amino acid transporter 1, SN1system N1 Na+ and H+-coupled glutamine transporter, SNAT3, Solute carrier family 38 member 3, solute carrier family 38, member 3, System N amino acid transporter 1
Host Species: Rabbit
Molecular Weight of Antigen: 56 kDa
Quantity: 20 μL
Primary or Secondary: Primary
Test Specificity: __
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry
Concentration: __
Dilution: Western Blot 1:100-1:2000, Immunohistochemistry
Gene Accession No.: Q99624
Gene Symbols: SLC38A3
Immunogen: Synthetic peptides corresponding to SLC38A3(solute carrier family 38, member 3) The peptide sequence was selected from the N terminal of SLC38A3. Peptide sequence GNQRVEDPARSCMEGKSFLQKSPSKEPHFTDFEGKTSFGMSVFNLSNAIM.
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 10991
Reconstitution: __
Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
Antigen: LRRN4CL
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: LRRN4 C-terminal like, LRRN4 C-terminal-like protein, MGC61707
Host Species: Rabbit
Molecular Weight of Antigen: __
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Equine: 92%; Rat: 92%.
Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Isotype: IgG
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: Q8ND94
Gene Symbols: LRRN4CL
Immunogen: Synthetic peptides corresponding to LOC221091 The peptide sequence was selected from the middle region of LOC221091. Peptide sequence PFSPVLHYWLLLWDGSEAAQKGPPLNATVRRAELKGLKPGGIYVVCVVAA.
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 221091
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.