SLC10A1 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP160109-Each-of-1 | In Stock | ₹ 42,908.34 |
NBP160109 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 42,908.34
GST (18%): ₹ 7,723.501
Total Price: ₹ 50,631.841
Antigen
SLC10A1
Classification
Polyclonal
Conjugate
Unconjugated
Formulation
PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias
Cell growth-inhibiting gene 29 protein, Na(+)/bile acid cotransporter, Na(+)/taurocholate transport protein, Na/taurocholate cotransporting polypeptide, NTCP, NTCP1, NTCPgrowth-inhibiting protein 29, sodium/bile acid cotransporter, sodium/taurocholate cotransporter, Sodium/taurocholate cotransporting polypeptide, solute carrier family 10 (sodium/bile acid cotransporter family), member 1, Solute carrier family 10 member 1
Host Species
Rabbit
Molecular Weight of Antigen
38 kDa
Quantity
100 μL
Primary or Secondary
Primary
Reconstitution
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Flow Cytometry, Blocking Assay
Concentration
0.5 mg/ml
Dilution
Western Blot 1.0 ug/ml, Flow Cytometry, Blocking Assay
Gene Accession No.
Q14973
Gene Symbols
SLC10A1
Immunogen
Synthetic peptides corresponding to SLC10A1(solute carrier family 10 (sodium/bile acid cotransporter family), member 1) The peptide sequence was selected from the middle region of SLC10A1 (NP_003040). Peptide sequence VFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLYIYSRGIYDGDLKDKVPY The peptide sequence for this immunogen was taken from within the described region.
Purification Method
Affinity purified
Regulatory Status
RUO
Gene ID (Entrez)
6554
Target Species
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Isotype
IgG
Related Products
Description
- SLC10A1 Polyclonal specifically detects SLC10A1 in Human samples
- It is validated for Western Blot, Flow Cytometry, Block/Neutralize.
Compare Similar Items
Show Difference
Antigen: SLC10A1
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: Cell growth-inhibiting gene 29 protein, Na(+)/bile acid cotransporter, Na(+)/taurocholate transport protein, Na/taurocholate cotransporting polypeptide, NTCP, NTCP1, NTCPgrowth-inhibiting protein 29, sodium/bile acid cotransporter, sodium/taurocholate cotransporter, Sodium/taurocholate cotransporting polypeptide, solute carrier family 10 (sodium/bile acid cotransporter family), member 1, Solute carrier family 10 member 1
Host Species: Rabbit
Molecular Weight of Antigen: 38 kDa
Quantity: 100 μL
Primary or Secondary: Primary
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Flow Cytometry, Blocking Assay
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml, Flow Cytometry, Blocking Assay
Gene Accession No.: Q14973
Gene Symbols: SLC10A1
Immunogen: Synthetic peptides corresponding to SLC10A1(solute carrier family 10 (sodium/bile acid cotransporter family), member 1) The peptide sequence was selected from the middle region of SLC10A1 (NP_003040). Peptide sequence VFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLYIYSRGIYDGDLKDKVPY The peptide sequence for this immunogen was taken from within the described region.
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 6554
Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Isotype: IgG
Antigen: ZDHHC14
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: DHHC domain containing 14, DHHC-14, EC 2.3.1, EC 2.3.1.-, NEW1 domain-containing protein, zinc finger, DHHC-type containing 14
Host Species: Rabbit
Molecular Weight of Antigen: __
Quantity: 100 μL
Primary or Secondary: Primary
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: Q8IZN3
Gene Symbols: ZDHHC14
Immunogen: Synthetic peptides corresponding to ZDHHC14(zinc finger, DHHC-type containing 14) The peptide sequence was selected from the N terminal of ZDHHC14. Peptide sequence TLLRTSFSDPGVLPRATPDEAADLERQIDIANGTSSGGYRPPPRTKEVII.
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 79683
Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Isotype: IgG
Antigen: TRAM1L1
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: MGC26568, translocating chain-associated membrane protein 1-like 1, translocation associated membrane protein 1-like 1
Host Species: Rabbit
Molecular Weight of Antigen: __
Quantity: 100 μL
Primary or Secondary: Primary
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: Q8N609
Gene Symbols: TRAM1L1
Immunogen: Synthetic peptides corresponding to TRAM1L1(translocation associated membrane protein 1-like 1) The peptide sequence was selected from the middle region of TRAM1L1. Peptide sequence LWAIVFILGRLVTLIVSVLTVGFHLAGSQNRNPDALTGNVNVLAAKIAVL.
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 133022
Target Species: Human, Canine, Rabbit
Isotype: IgG
