MAP3K8/Tpl2/COT Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP162178-Each-of-1 | In Stock | ₹ 58,822.50 |
NBP162178 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 58,822.50
GST (18%): ₹ 10,588.05
Total Price: ₹ 69,410.55
Antigen
MAP3K8/Tpl2/COT
Classification
Polyclonal
Dilution
Western Blot > 1:500, ELISA < 1:10000, Immunohistochemistry 1:50-1:150, Immunoprecipitation 1:200, Immunohistochemistry-Paraffin 1:50-1:150
Gene Alias
Cancer Osaka thyroid oncogene, c-COT, cot (cancer Osaka thyroid) oncogene, COTMEKK8, EC 2.7.11.25, ESTF, ESTFLJ10486, Ewing sarcoma transformant, mitogen-activated protein kinase kinase kinase 8, Proto-oncogene c-Cot, proto-oncogene serine/threoine protein kinase, Serine/threonine-protein kinase cot, Tpl-2, TPL2, Tumor progression locus 2, tumor progression locus-2
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
1326
Target Species
Human, Mouse, Rat
Isotype
IgG
Applications
Western Blot, ELISA, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
Tris/Glycine buffer, pH 7.4-7.8, HEPES,BSA 0.5%, glycerol 30%. with 0.02% Sodium Azide
Gene Symbols
MAP3K8
Immunogen
Synthetic peptides corresponding to unique epitope on MAP3K8. The peptide sequence was selected from C-terminal-region, amimo acids 365-467. This peptide was covalently modified post-synthetically to achieve desired antigenicity.
Quantity
100 μg Reaction
Primary or Secondary
Primary
Test Specificity
This antibody detects a single band of approximately 57kDa in PC-MAP3K8 samples
Content And Storage
Store at -20C. Avoid freeze-thaw cycles.
Related Products
Description
- MAP3K8/Tpl2/COT Polyclonal specifically detects MAP3K8/Tpl2/COT in Human, Mouse, Rat samples
- It is validated for Western Blot, ELISA, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: MAP3K8/Tpl2/COT
Classification: Polyclonal
Dilution: Western Blot > 1:500, ELISA < 1:10000, Immunohistochemistry 1:50-1:150, Immunoprecipitation 1:200, Immunohistochemistry-Paraffin 1:50-1:150
Gene Alias: Cancer Osaka thyroid oncogene, c-COT, cot (cancer Osaka thyroid) oncogene, COTMEKK8, EC 2.7.11.25, ESTF, ESTFLJ10486, Ewing sarcoma transformant, mitogen-activated protein kinase kinase kinase 8, Proto-oncogene c-Cot, proto-oncogene serine/threoine protein kinase, Serine/threonine-protein kinase cot, Tpl-2, TPL2, Tumor progression locus 2, tumor progression locus-2
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 1326
Target Species: Human, Mouse, Rat
Isotype: IgG
Applications: Western Blot, ELISA, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: Tris/Glycine buffer, pH 7.4-7.8, HEPES,BSA 0.5%, glycerol 30%. with 0.02% Sodium Azide
Gene Symbols: MAP3K8
Immunogen: Synthetic peptides corresponding to unique epitope on MAP3K8. The peptide sequence was selected from C-terminal-region, amimo acids 365-467. This peptide was covalently modified post-synthetically to achieve desired antigenicity.
Quantity: 100 μg Reaction
Primary or Secondary: Primary
Test Specificity: This antibody detects a single band of approximately 57kDa in PC-MAP3K8 samples
Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: __
Host Species: __
Purification Method: Affinity purified
Regulatory Status: RUO - research use only
Gene ID (Entrez): 1326
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: __
Gene Symbols: __
Immunogen: __
Quantity: 0.25 mg
Primary or Secondary: __
Test Specificity: __
Content And Storage: -80°C. Avoid freeze-thaw cycles.
Antigen: DPY19L2
Classification: Polyclonal
Dilution: Western Blot
Gene Alias: dpy-19-like 2 (C. elegans), Dpy-19-like protein 2, FLJ32949, FLJ36166, protein dpy-19 homolog 2
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 283417
Target Species: Human
Isotype: IgG
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Symbols: DPY19L2
Immunogen: Synthetic peptides corresponding to DPY19L2(dpy-19-like 2 (C. elegans)) The peptide sequence was selected form the middle region of DPY19L2. Peptide sequence IIGEFNNLPQEELLQWIKYSTTSDAVFAGAMPTMASIKLSTLHPIVNHPH.
Quantity: 20 μL
Primary or Secondary: Primary
Test Specificity: __
Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
