Collagen I alpha 1 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP168942-Each-of-1 | In Stock | ₹ 41,710.50 |
NBP168942 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
Antigen
Collagen I alpha 1
Classification
Polyclonal
Conjugate
Unconjugated
Formulation
PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias
Alpha-1 type I collagen, COL-IA1, Collagen 1, Collagen 1 alpha 1, collagen alpha 1 chain type I, collagen alpha-1(I) chain, collagen of skin, tendon and bone, alpha-1 chain, Collagen Type I Alpha 1 Chain, collagen, type I, alpha 1, Collagen1, Collagen-1, EDSARTH1, OI4, pro-alpha-1 collagen type 1, Type I Procollagen Alpha 1 Chain
Host Species
Rabbit
Molecular Weight of Antigen
139 kDa
Quantity
100 μL
Research Discipline
Cell Biology, Cellular Markers, Extracellular Matrix, Signal Transduction, Stem Cells
Gene ID (Entrez)
1277
Reconstitution
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications
Western Blot
Concentration
0.5 mg/ml
Dilution
Western Blot 1.0 ug/ml, ELISA
Gene Accession No.
P02452
Gene Symbols
COL1A1
Immunogen
This Collagen I alpha 1 antibody was raised against synthetic peptides corresponding to COL1A1 (collagen, type I, alpha 1) The peptide sequence was selected from the C terminal of COL1A1. Peptide sequence YRADDANVVRDRDLEVDTTLKSLSQQIENIRSPEGSRKNPARTCRDLKMC.
Purification Method
Affinity purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Expected identity based on immunogen sequence: Bovine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Xenopus: 92%; Guinea pig: 92%.
Target Species
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Isotype
IgG
Related Products
Description
- Collagen I alpha 1 Polyclonal specifically detects Collagen I alpha 1 in Human samples
- It is validated for Western Blot, ELISA.
Compare Similar Items
Show Difference
Antigen: Collagen I alpha 1
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias: Alpha-1 type I collagen, COL-IA1, Collagen 1, Collagen 1 alpha 1, collagen alpha 1 chain type I, collagen alpha-1(I) chain, collagen of skin, tendon and bone, alpha-1 chain, Collagen Type I Alpha 1 Chain, collagen, type I, alpha 1, Collagen1, Collagen-1, EDSARTH1, OI4, pro-alpha-1 collagen type 1, Type I Procollagen Alpha 1 Chain
Host Species: Rabbit
Molecular Weight of Antigen: 139 kDa
Quantity: 100 μL
Research Discipline: Cell Biology, Cellular Markers, Extracellular Matrix, Signal Transduction, Stem Cells
Gene ID (Entrez): 1277
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml, ELISA
Gene Accession No.: P02452
Gene Symbols: COL1A1
Immunogen: This Collagen I alpha 1 antibody was raised against synthetic peptides corresponding to COL1A1 (collagen, type I, alpha 1) The peptide sequence was selected from the C terminal of COL1A1. Peptide sequence YRADDANVVRDRDLEVDTTLKSLSQQIENIRSPEGSRKNPARTCRDLKMC.
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Xenopus: 92%; Guinea pig: 92%.
Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Isotype: IgG
Antigen: Acidic Calponin
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: calponin 3, acidic, Calponin, acidic isoform, calponin-3, dJ639P13.2.2 (acidic calponin 3)
Host Species: Rabbit
Molecular Weight of Antigen: 36 kDa
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 1266
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: Q15417
Gene Symbols: CNN3
Immunogen: Synthetic peptides corresponding to CNN3 (calponin 3, acidic) The peptide sequence was selected from the C terminal of CNN3. Peptide sequence GLGRQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDYQAEYPDEYHGE.
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: __
Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Isotype: IgG
Antigen: CLTB
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: clathrin light chain B, clathrin, light chain (Lcb), clathrin, light chain B, clathrin, light polypeptide (Lcb), Lcb
Host Species: Rabbit
Molecular Weight of Antigen: 25 kDa
Quantity: 100 μL
Research Discipline: Golgi Apparatus Markers
Gene ID (Entrez): 1212
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: P09497
Gene Symbols: CLTB
Immunogen: Synthetic peptides corresponding to CLTB (clathrin, light chain (Lcb)) The peptide sequence was selected from the C terminal of CLTB. Peptide sequence ADIIGYVASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLR.
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: __
Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Isotype: IgG
