PPP2R2C Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP16916020-Each-of-1 | In Stock | ₹ 17,710.92 |
NBP16916020 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 17,710.92
GST (18%): ₹ 3,187.966
Total Price: ₹ 20,898.886
Antigen
PPP2R2C
Classification
Polyclonal
Dilution
Western Blot 1:100-1:2000
Gene Accession No.
Q9Y2T4
Gene Symbols
PPP2R2C
Immunogen
Synthetic peptides corresponding to Ppp2r2c (protein phosphatase 2 (formerly 2A), regulatory subunit B (PR 52), gamma isoform) The peptide sequence was selected from the N terminal of Ppp2r2c. Peptide sequence VTEADVISTVEFNHTGELLATGDKGGRVV
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
5522
Target Species
Human, Mouse
Isotype
IgG
Applications
Western Blot
Conjugate
Unconjugated
Formulation
PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias
B55-GAMMA, IMYPNO1, phosphoprotein phosphatase 2A BR gamma regulatory chain, PP2A subunit B isoform B55-gamma, PP2A subunit B isoform gamma, PP2A subunit B isoform PR55-gamma, PP2A subunit B isoform R2-gamma, PP2A, subunit B, B55-gamma isoform, PP2A, subunit B, B-gamma isoform, PP2A, subunit B, PR55-gamma isoform, PP2A, subunit B, R2-gamma isoform, PR55G, protein phosphatase 2, protein phosphatase 2 (formerly 2A), regulatory subunit B (PR 52), gammaisoform, protein phosphatase 2 (formerly 2A), regulatory subunit B, gamma isoform, protein phosphatase 2, regulatory subunit B, gamma, protein phosphatase 2A1 B gamma subunit, serine/threonine protein phosphatase 2A, 55 KDA regulatory subunit B, gammaisoform, serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B gammaisoform
Host Species
Rabbit
Molecular Weight of Antigen
49 kDa
Quantity
20 μL
Primary or Secondary
Primary
Test Specificity
This product is specific to Subunit or Isoform: B gamma isoform.
Content And Storage
Store at -20C. Avoid freeze-thaw cycles.
Description
- PPP2R2C Polyclonal specifically detects PPP2R2C in Mouse samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: PPP2R2C
Classification: Polyclonal
Dilution: Western Blot 1:100-1:2000
Gene Accession No.: Q9Y2T4
Gene Symbols: PPP2R2C
Immunogen: Synthetic peptides corresponding to Ppp2r2c (protein phosphatase 2 (formerly 2A), regulatory subunit B (PR 52), gamma isoform) The peptide sequence was selected from the N terminal of Ppp2r2c. Peptide sequence VTEADVISTVEFNHTGELLATGDKGGRVV
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 5522
Target Species: Human, Mouse
Isotype: IgG
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias: B55-GAMMA, IMYPNO1, phosphoprotein phosphatase 2A BR gamma regulatory chain, PP2A subunit B isoform B55-gamma, PP2A subunit B isoform gamma, PP2A subunit B isoform PR55-gamma, PP2A subunit B isoform R2-gamma, PP2A, subunit B, B55-gamma isoform, PP2A, subunit B, B-gamma isoform, PP2A, subunit B, PR55-gamma isoform, PP2A, subunit B, R2-gamma isoform, PR55G, protein phosphatase 2, protein phosphatase 2 (formerly 2A), regulatory subunit B (PR 52), gammaisoform, protein phosphatase 2 (formerly 2A), regulatory subunit B, gamma isoform, protein phosphatase 2, regulatory subunit B, gamma, protein phosphatase 2A1 B gamma subunit, serine/threonine protein phosphatase 2A, 55 KDA regulatory subunit B, gammaisoform, serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B gammaisoform
Host Species: Rabbit
Molecular Weight of Antigen: 49 kDa
Quantity: 20 μL
Primary or Secondary: Primary
Test Specificity: This product is specific to Subunit or Isoform: B gamma isoform.
Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
Antigen: IL-5
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: __
Gene Symbols: IL5
Immunogen: Synthetic peptides corresponding to Il5 (interleukin 5) The peptide sequence was selected from the middle region of Il5. Peptide sequence MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGL.
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 3567
Target Species: Human, Mouse, Rat, Guinea Pig, Rabbit
Isotype: IgG
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: B-cell differentiation factor I, EDF, Eosinophil differentiation factor, IL-5T-cell replacing factor, interleukin 5 (colony-stimulating factor, eosinophil), interleukin-5, TRFB cell differentiation factor I
Host Species: Rabbit
Molecular Weight of Antigen: 15 kDa
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Pig: 86%.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Antigen: IL-5
Classification: Polyclonal
Dilution: Western Blot 0.2-1 ug/ml
Gene Accession No.: __
Gene Symbols: IL5
Immunogen: Synthetic peptides corresponding to Il5 (interleukin 5) The peptide sequence was selected from the middle region of Il5. Peptide sequence MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGL.
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 3567
Target Species: Mouse
Isotype: IgG
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias: B-cell differentiation factor I, EDF, Eosinophil differentiation factor, IL-5T-cell replacing factor, interleukin 5 (colony-stimulating factor, eosinophil), interleukin-5, TRFB cell differentiation factor I
Host Species: Rabbit
Molecular Weight of Antigen: 15 kDa
Quantity: 20 μL
Primary or Secondary: Primary
Test Specificity: __
Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
