Manufacturer: Novus Biologicals
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP169635-Each-of-1 | In Stock | ₹ 43,387.50 |
NBP169635 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 43,387.50
GST (18%): ₹ 7,809.75
Total Price: ₹ 51,197.25
IL-28R alpha/IFN-lambda R1
Polyclonal
Unconjugated
PBS, 2% Sucrose with 0.09% Sodium Azide
class II cytokine receptor CRF2/12, CRF2/12, CRF2-12, Cytokine receptor class-II member 12, Cytokine receptor family 2 member 12, IFN-lambda receptor 1, IFN-lambda-R1, IFNLR, IFNLR1, IL-28 receptor subunit alpha, IL-28R1, IL-28RA, IL-28R-alpha, Interferon lambda receptor 1, interferon lambda, receptor 1, interleukin 28 receptor A, interleukin 28 receptor, alpha, interleukin 28 receptor, alpha (interferon, lambda receptor), interleukin or cytokine receptor 2, interleukin-28 receptor subunit alpha, LICR2, Likely interleukin or cytokine receptor 2
Rabbit
54 kDa
100 μL
Apoptosis, Cytokine Research
163702
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot
0.5 mg/ml
Western Blot 1.0 ug/ml
Q5VTX8
IFNLR1
Synthetic peptides corresponding to IL28RA(interleukin 28 receptor, alpha (interferon, lambda receptor)) The peptide sequence was selected from the N terminal of IL28RA. Peptide sequence EECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLF.
Affinity purified
RUO
Primary
This product is specific to Subunit or Isoform: alpha.
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
IgG