DHRS3 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP179192-Each-of-1 | In Stock | ₹ 41,710.50 |
NBP179192 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
Antigen
DHRS3
Classification
Polyclonal
Conjugate
Unconjugated
Formulation
PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias
DD83.1, dehydrogenase/reductase (SDR family) member 3, EC 1.1.1, EC 1.1.1.300, RDH17, Retinal short-chain dehydrogenase/reductase 1, RETSDR1, retSDR1short chain dehydrogenase/reductase family 16C, member 1, Rsdr1, SDR1, SDR16C1, short-chain dehydrogenase/reductase 1, short-chain dehydrogenase/reductase 3
Host Species
Rabbit
Purification Method
Affinity purified
Regulatory Status
RUO
Gene ID (Entrez)
9249
Reconstitution
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications
Western Blot
Concentration
0.5 mg/ml
Dilution
Western Blot 1.0 ug/ml
Gene Accession No.
NP_035433
Gene Symbols
DHRS3
Immunogen
The immunogen for this antibody is Dhrs3. Peptide sequence PGVSATTVLPFHTSTEMFQGMRVRFPNLFPPLKPETVARRTVDAVQQNQA.
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Expected identity based on immunogen sequence: Bovine: 100%; Chicken: 100%; Canine: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Guinea pig: 92%; Mouse: 92%; Xenopus: 78%; Zebrafish: 78%.
Target Species
Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Isotype
IgG
Related Products
Description
- DHRS3 Polyclonal specifically detects DHRS3 in Mouse samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: DHRS3
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: DD83.1, dehydrogenase/reductase (SDR family) member 3, EC 1.1.1, EC 1.1.1.300, RDH17, Retinal short-chain dehydrogenase/reductase 1, RETSDR1, retSDR1short chain dehydrogenase/reductase family 16C, member 1, Rsdr1, SDR1, SDR16C1, short-chain dehydrogenase/reductase 1, short-chain dehydrogenase/reductase 3
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 9249
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: NP_035433
Gene Symbols: DHRS3
Immunogen: The immunogen for this antibody is Dhrs3. Peptide sequence PGVSATTVLPFHTSTEMFQGMRVRFPNLFPPLKPETVARRTVDAVQQNQA.
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Chicken: 100%; Canine: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Guinea pig: 92%; Mouse: 92%; Xenopus: 78%; Zebrafish: 78%.
Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Isotype: IgG
Antigen: Phospholemman
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: FXYD domain containing ion transport regulator 1, FXYD domain-containing ion transport regulator 1, MGC44983, PLMphospholemman
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 5348
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: NP_005022
Gene Symbols: FXYD1
Immunogen: Synthetic peptide directed towards the N terminal of human FXYD1. Peptide sequence ASLGHILVFCVGLLTMAKAESPKEHDPFTYDYQSLQIGGLVIAGILFILG.
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: __
Target Species: Human, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit
Isotype: IgG
Antigen: TMEM184B
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: DKFZp586A1024, DKFZp686F07174, DKFZp686N1150, FM08, PSEC0108, transmembrane protein 184B
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 25829
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: NP_001166841
Gene Symbols: TMEM184B
Immunogen: The immunogen for this antibody is Tmem184b. Peptide sequence STVILQAFGKYRDGDFDVTSGYLYVTIIYNISVSLALYALFLFYFATREL.
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Equine: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Chicken: 92%; Canine: 92%; Xenopus: 85%.
Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Isotype: IgG