ST6GALNAC1 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP179210-Each-of-1 | In Stock | ₹ 42,908.34 |
NBP179210 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 42,908.34
GST (18%): ₹ 7,723.501
Total Price: ₹ 50,631.841
Antigen
ST6GALNAC1
Classification
Polyclonal
Conjugate
Unconjugated
Formulation
PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias
alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1, EC 2.4.99.3, GalNAc alpha-2, 6-sialyltransferase I, long form, GalNAc alpha-2,6-sialyltransferase I, sialyltransferase 7((alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminidealpha-2,6-sialyltransferase) A, Sialyltransferase 7A, SIAT7A, SIAT7-A, ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminidealpha-2,6-sialyltransferase 1, ST6GalNAc I, ST6GalNAcIHSY11339, STYI
Host Species
Rabbit
Purification Method
Affinity purified
Regulatory Status
RUO
Gene ID (Entrez)
55808
Reconstitution
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications
Western Blot
Concentration
0.5 mg/ml
Dilution
Western Blot 1.0 ug/ml
Gene Accession No.
NP_035501
Gene Symbols
ST6GALNAC1
Immunogen
The immunogen for this antibody is St6galnac1. Peptide sequence GALLLLTALHLCDKVSAYGFITEGHQRFSDHYYDTSWKRLIFYINHDFRL.
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Equine: 100%; Pig: 100%; Rabbit: 100%; Mouse: 92%; Rat: 92%.
Target Species
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Isotype
IgG
Related Products
Description
- ST6GALNAC1 Polyclonal specifically detects ST6GALNAC1 in Mouse samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: ST6GALNAC1
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1, EC 2.4.99.3, GalNAc alpha-2, 6-sialyltransferase I, long form, GalNAc alpha-2,6-sialyltransferase I, sialyltransferase 7((alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminidealpha-2,6-sialyltransferase) A, Sialyltransferase 7A, SIAT7A, SIAT7-A, ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminidealpha-2,6-sialyltransferase 1, ST6GalNAc I, ST6GalNAcIHSY11339, STYI
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 55808
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: NP_035501
Gene Symbols: ST6GALNAC1
Immunogen: The immunogen for this antibody is St6galnac1. Peptide sequence GALLLLTALHLCDKVSAYGFITEGHQRFSDHYYDTSWKRLIFYINHDFRL.
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Equine: 100%; Pig: 100%; Rabbit: 100%; Mouse: 92%; Rat: 92%.
Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Isotype: IgG
Antigen: DBX2
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: developing brain homeobox 2, developing brain homeobox protein 2, FLJ16139, homeobox protein DBX2
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 440097
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: NP_001004329
Gene Symbols: DBX2
Immunogen: Synthetic peptide directed towards the N terminal of human DBX2The immunogen for this antibody is DBX2. Peptide sequence ALLNLPAAPGFGNLGKSFLIENLLRVGGAPTPRLQPPAPHDPATALATAG.
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Human: 100%.
Target Species: Human
Isotype: IgG
Antigen: ETV3L
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: ets variant 3-like, ets variant gene 3-like
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 440695
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: NP_001004341
Gene Symbols: ETV3L
Immunogen: Synthetic peptide directed towards the C terminal of human ETV3LThe immunogen for this antibody is ETV3L. Peptide sequence LPPLPSEQQLPGAFKPDILLPGPRSLPGAWHFPGLPLLAGLGQGAGERLW.
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Canine: 92%.
Target Species: Human, Porcine, Canine, Rabbit
Isotype: IgG
