CHRFAM7A Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP180091-Each-of-1 | In Stock | ₹ 41,710.50 |
NBP180091 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
Antigen
CHRFAM7A
Classification
Polyclonal
Conjugate
Unconjugated
Formulation
PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias
CHRNA7, CHRNA7 (cholinergic receptor, nicotinic, alpha 7, exons 5-10) and FAM7A (familywith sequence similarity 7A, exons A-E) fusion, CHRNA7 (cholinergic receptor, nicotinic, alpha polypeptide 7, exons 5-10) andFAM7A (family with sequence similarity 7A, exons A-E) fusion, CHRNA7-DR1alpha 7 neuronal nicotinic acetylcholine receptor-FAM7A hybrid, CHRNA7-FAM7A fusion protein, D-10alpha-7 nicotinic cholinergic receptor subunit, MGC120482, MGC120483
Host Species
Rabbit
Purification Method
Affinity purified
Regulatory Status
RUO
Gene ID (Entrez)
89832
Reconstitution
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications
Western Blot
Concentration
0.5 mg/ml
Dilution
Western Blot 1.0 ug/ml
Gene Accession No.
NP_647536
Gene Symbols
CHRFAM7A
Immunogen
Synthetic peptide directed towards the N terminal of human CHRFAM7A. Peptide sequence QFQLLIQHLWIAANCDIADERFDATFHTNVLVNSSGHCQYLPPGIFKSSC.
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Expected identity based on immunogen sequence: Bovine: 100%; Rhesus macaque: 100%; Japanese pufferfish: 100%; Green puffer: 100%; Cat: 100%; Rat: 100%; Mouse: 100%; Chicken: 100%; Egyptian mongoose: 100%; Zebrafish: 100%; Human: 100%; Sweetpotato whitefly: 85%.
Target Species
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Isotype
IgG
Related Products
Description
- CHRFAM7A Polyclonal specifically detects CHRFAM7A in Human samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: CHRFAM7A
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: CHRNA7, CHRNA7 (cholinergic receptor, nicotinic, alpha 7, exons 5-10) and FAM7A (familywith sequence similarity 7A, exons A-E) fusion, CHRNA7 (cholinergic receptor, nicotinic, alpha polypeptide 7, exons 5-10) andFAM7A (family with sequence similarity 7A, exons A-E) fusion, CHRNA7-DR1alpha 7 neuronal nicotinic acetylcholine receptor-FAM7A hybrid, CHRNA7-FAM7A fusion protein, D-10alpha-7 nicotinic cholinergic receptor subunit, MGC120482, MGC120483
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 89832
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: NP_647536
Gene Symbols: CHRFAM7A
Immunogen: Synthetic peptide directed towards the N terminal of human CHRFAM7A. Peptide sequence QFQLLIQHLWIAANCDIADERFDATFHTNVLVNSSGHCQYLPPGIFKSSC.
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Rhesus macaque: 100%; Japanese pufferfish: 100%; Green puffer: 100%; Cat: 100%; Rat: 100%; Mouse: 100%; Chicken: 100%; Egyptian mongoose: 100%; Zebrafish: 100%; Human: 100%; Sweetpotato whitefly: 85%.
Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Isotype: IgG
Antigen: Nicotinic Acetylcholine R alpha 7/CHRNA7
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: a7 nicotinic acetylcholine receptor, alpha 7 neuronal nicotinic acetylcholine receptor, alpha-7 nicotinic cholinergic receptor subunit, cholinergic receptor, nicotinic, alpha 7, cholinergic receptor, nicotinic, alpha polypeptide 7, CHRNA7-2, NACHRA7, neuronal acetylcholine receptor protein, alpha-7 chain, neuronal acetylcholine receptor subunit alpha-7
Host Species: Rabbit
Purification Method: Protein A purified
Regulatory Status: RUO
Gene ID (Entrez): 1139
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Concentration: 1 mg/ml
Dilution: Western Blot 1.0 ug/ml, Immunocytochemistry/Immunofluorescence
Gene Accession No.: NP_000737
Gene Symbols: CHRNA7
Immunogen: Synthetic peptide directed towards the middle region of human CHRNA7. Peptide sequence VPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRF.
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Chicken: 100%; Equine: 100%; Human: 100%; Pig: 100%; Canine: 92%; Mouse: 92%; Rat: 92%.
Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Isotype: IgG
Antigen: KCTD18
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: BTB/POZ domain-containing protein KCTD18, FLJ31322, FLJ37818, potassium channel tetramerisation domain containing 18,6530404F10Rik
Host Species: Rabbit
Purification Method: Protein A purified
Regulatory Status: RUO
Gene ID (Entrez): 130535
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Concentration: 1 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: NP_689600
Gene Symbols: KCTD18
Immunogen: Synthetic peptide directed towards the N terminal of human KCTD18. Peptide sequence LHYLNTSGASCESRIIGVYATKTDGTDAIEKQLGGRIHSKGIFKREAGNN.
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Canine: 92%; Equine: 92%; Mouse: 92%; Rat: 92%; Rabbit: 85%.
Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Rabbit
Isotype: IgG