BRF1 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP180249-Each-of-1 | In Stock | ₹ 41,710.50 |
NBP180249 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
Antigen
BRF1
Classification
Polyclonal
Conjugate
Unconjugated
Formulation
PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias
B-related factor 1, BRF-1, BRF1 homolog, subunit of RNA polymerase III transcription initiation factorIIIB (S. cerevisiae), BRFFLJ42674, general transcription factor IIIB, 90kD subunit, GTF3BTAFIII90, hBRFMGC105048, hTFIIIB90, TAF3B2, TAF3CB - related factor 1, TATA box binding protein (TBP)-associated factor 3C, TATA box binding protein (TBP)-associated factor, RNA polymerase III, GTF3Bsubunit 2, TATA box binding protein (TBP)-associated factor, RNA polymerase III, subunit 2, TATA box-binding protein-associated factor, RNA polymerase III, subunit 2, TBP - associated factor, RNA polymerase III, 90kD, TF3B90, TFIIIB90FLJ43034, transcription factor IIIB 90 kDa subunit
Host Species
Rabbit
Molecular Weight of Antigen
22 kDa
Quantity
100 μL
Primary or Secondary
Primary
Reconstitution
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype
IgG
Applications
Western Blot
Concentration
1 mg/ml
Dilution
Western Blot 1.0 ug/ml
Gene Accession No.
AAH58112
Gene Symbols
BRF1
Immunogen
Synthetic peptide directed towards the C terminal of human BRF1. Peptide sequence PALGAEPIKPSAVLVESGPVSYHPEEDADEEDAEDEDGEPCVSALQMMGG.
Purification Method
Protein A purified
Regulatory Status
RUO
Gene ID (Entrez)
2972
Target Species
Mouse, Rat, Bovine, Canine
Form
Purified
Related Products
Description
- BRF1 Polyclonal specifically detects BRF1 in Mouse samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: BRF1
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: B-related factor 1, BRF-1, BRF1 homolog, subunit of RNA polymerase III transcription initiation factorIIIB (S. cerevisiae), BRFFLJ42674, general transcription factor IIIB, 90kD subunit, GTF3BTAFIII90, hBRFMGC105048, hTFIIIB90, TAF3B2, TAF3CB - related factor 1, TATA box binding protein (TBP)-associated factor 3C, TATA box binding protein (TBP)-associated factor, RNA polymerase III, GTF3Bsubunit 2, TATA box binding protein (TBP)-associated factor, RNA polymerase III, subunit 2, TATA box-binding protein-associated factor, RNA polymerase III, subunit 2, TBP - associated factor, RNA polymerase III, 90kD, TF3B90, TFIIIB90FLJ43034, transcription factor IIIB 90 kDa subunit
Host Species: Rabbit
Molecular Weight of Antigen: 22 kDa
Quantity: 100 μL
Primary or Secondary: Primary
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype: IgG
Applications: Western Blot
Concentration: 1 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: AAH58112
Gene Symbols: BRF1
Immunogen: Synthetic peptide directed towards the C terminal of human BRF1. Peptide sequence PALGAEPIKPSAVLVESGPVSYHPEEDADEEDAEDEDGEPCVSALQMMGG.
Purification Method: Protein A purified
Regulatory Status: RUO
Gene ID (Entrez): 2972
Target Species: Mouse, Rat, Bovine, Canine
Form: Purified
Antigen: ZNF607
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS & 2% Sucrose. with No Preservative
Gene Alias: FLJ14802, MGC13071, zinc finger protein 607
Host Species: Rabbit
Molecular Weight of Antigen: 81 kDa
Quantity: 20 μL
Primary or Secondary: Primary
Reconstitution: __
Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
Isotype: IgG
Applications: Western Blot
Concentration: __
Dilution: Western Blot 1:1000
Gene Accession No.: NP_116078
Gene Symbols: ZNF607
Immunogen: Synthetic peptide directed towards the middle region of human ZNF607. Peptide sequence KECGKGFTCRYQLTMHQRIYSGEKHYECKENGEAFSSGHQLTAPHTFESV.
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 84775
Target Species: Human
Form: __
Antigen: NFAT5
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: EC 3.6.1, EC 3.6.3.14, KIAA0827glutamine rich protein H65, NF-AT5NFAT-like protein 1, NFATL1, NFATZ, nuclear factor of activated T-cells 5, tonicity-responsive, OREBP, osmotic response element-binding protein, T-cell transcription factor NFAT5, TonE-binding protein, TonEBP, TONEBPnuclear factor of activated T-cells 5, Tonicity-responsive enhancer-binding protein
Host Species: Rabbit
Molecular Weight of Antigen: 166 kDa
Quantity: 100 μL
Primary or Secondary: Primary
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype: IgG
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: AAF79117
Gene Symbols: NFAT5
Immunogen: Synthetic peptide directed towards the middle region of mouse NFAT5. Peptide sequence TIQTQDISQPGTFPAVSAASQLPSSDALLQQATQFQTREAQSRDTIQSDT.
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 10725
Target Species: Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit
Form: __
