BRF1 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP18044020-Each-of-1 | In Stock | ₹ 17,625.36 |
NBP18044020 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 17,625.36
GST (18%): ₹ 3,172.565
Total Price: ₹ 20,797.925
Antigen
BRF1
Classification
Polyclonal
Dilution
Western Blot 1:1000
Gene Accession No.
NP_082469
Gene Symbols
BRF1
Immunogen
Synthetic peptide directed towards the C terminal of mouse BRF1. Peptide sequence GSPPRDDSQPPERASTKKLSRRKRATTRNSADPGTSTGKRLRPLLSAQPA.
Quantity
20 μL
Primary or Secondary
Primary
Target Species
Human, Mouse
Isotype
IgG
Applications
Western Blot
Conjugate
Unconjugated
Formulation
PBS & 2% Sucrose. with No Preservative
Gene Alias
B-related factor 1, BRF-1, BRF1 homolog, subunit of RNA polymerase III transcription initiation factorIIIB (S. cerevisiae), BRFFLJ42674, general transcription factor IIIB, 90kD subunit, GTF3BTAFIII90, hBRFMGC105048, hTFIIIB90, TAF3B2, TAF3CB - related factor 1, TATA box binding protein (TBP)-associated factor 3C, TATA box binding protein (TBP)-associated factor, RNA polymerase III, GTF3Bsubunit 2, TATA box binding protein (TBP)-associated factor, RNA polymerase III, subunit 2, TATA box-binding protein-associated factor, RNA polymerase III, subunit 2, TBP - associated factor, RNA polymerase III, 90kD, TF3B90, TFIIIB90FLJ43034, transcription factor IIIB 90 kDa subunit
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
2972
Content And Storage
Store at -20C. Avoid freeze-thaw cycles.
Related Products
Description
- BRF1 Polyclonal specifically detects BRF1 in Human samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: BRF1
Classification: Polyclonal
Dilution: Western Blot 1:1000
Gene Accession No.: NP_082469
Gene Symbols: BRF1
Immunogen: Synthetic peptide directed towards the C terminal of mouse BRF1. Peptide sequence GSPPRDDSQPPERASTKKLSRRKRATTRNSADPGTSTGKRLRPLLSAQPA.
Quantity: 20 μL
Primary or Secondary: Primary
Target Species: Human, Mouse
Isotype: IgG
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS & 2% Sucrose. with No Preservative
Gene Alias: B-related factor 1, BRF-1, BRF1 homolog, subunit of RNA polymerase III transcription initiation factorIIIB (S. cerevisiae), BRFFLJ42674, general transcription factor IIIB, 90kD subunit, GTF3BTAFIII90, hBRFMGC105048, hTFIIIB90, TAF3B2, TAF3CB - related factor 1, TATA box binding protein (TBP)-associated factor 3C, TATA box binding protein (TBP)-associated factor, RNA polymerase III, GTF3Bsubunit 2, TATA box binding protein (TBP)-associated factor, RNA polymerase III, subunit 2, TATA box-binding protein-associated factor, RNA polymerase III, subunit 2, TBP - associated factor, RNA polymerase III, 90kD, TF3B90, TFIIIB90FLJ43034, transcription factor IIIB 90 kDa subunit
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 2972
Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
Antigen: RPL32
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: NP_000985
Gene Symbols: RPL32
Immunogen: Synthetic peptide directed towards the N terminal of human RPL32. Peptide sequence AALRPLVKPKIVKKRTKKFIRHQSDRYVKIKRNWRKPRGIDNRVRRRFKG.
Quantity: 100 μL
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish
Isotype: IgG
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: M, ribosomal protein L32,60S ribosomal protein L32
Host Species: Rabbit
Purification Method: Protein A purified
Regulatory Status: RUO
Gene ID (Entrez): 6161
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Antigen: DAZ2
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Gene Accession No.: NP_001005785
Gene Symbols: DAZ2
Immunogen: Synthetic peptide directed towards the N terminal of human DAZ2. Peptide sequence MDETEIGSCFGRYGSVKEVKIITNRTGVSKGYGFVSFVNDVDVQKIVGSQ.
Quantity: 100 μL
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: deleted in azoospermia 2, deleted in azoospermia protein 2, MGC126442
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 57055
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
