GATD3A Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP180552-Each-of-1 | In Stock | ₹ 41,710.50 |
NBP180552 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
Antigen
C21orf33
Classification
Polyclonal
Conjugate
Unconjugated
Formulation
PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias
chromosome 21 open reading frame 33, D21S2048E, ES1, GT335, HES1, HES1KNP-Ia, human HES1 protein, homolog to E.coli and zebrafish ES1 protein, 10Protein GT335, Keio novel protein I, KNPH, KNPI, KNP-I, KNPImitochondrial, Protein KNP-I
Host Species
Rabbit
Purification Method
Protein A purified
Regulatory Status
RUO
Gene ID (Entrez)
8209
Reconstitution
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype
IgG
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Concentration
1 mg/ml
Dilution
Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Gene Accession No.
NP_937798
Gene Symbols
C21ORF33
Immunogen
Synthetic peptide directed towards the N terminal of human C21orf33. Peptide sequence SRGGAEVQIFAPDVPQMHVIDHTKGQPSEGESRNVLTESARIARGKITDL.
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Expected identity based on immunogen sequence: Human: 100%; Sheep: 92%; Xenopus: 75%.
Target Species
Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Sheep, Zebrafish
Form
Purified
Related Products
Description
- GATD3A Polyclonal specifically detects GATD3A in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: C21orf33
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: chromosome 21 open reading frame 33, D21S2048E, ES1, GT335, HES1, HES1KNP-Ia, human HES1 protein, homolog to E.coli and zebrafish ES1 protein, 10Protein GT335, Keio novel protein I, KNPH, KNPI, KNP-I, KNPImitochondrial, Protein KNP-I
Host Species: Rabbit
Purification Method: Protein A purified
Regulatory Status: RUO
Gene ID (Entrez): 8209
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Concentration: 1 mg/ml
Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Gene Accession No.: NP_937798
Gene Symbols: C21ORF33
Immunogen: Synthetic peptide directed towards the N terminal of human C21orf33. Peptide sequence SRGGAEVQIFAPDVPQMHVIDHTKGQPSEGESRNVLTESARIARGKITDL.
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Sheep: 92%; Xenopus: 75%.
Target Species: Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Sheep, Zebrafish
Form: Purified
Antigen: C21orf62
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: B37, B37PRED81, C21orf120, chromosome 21 open reading frame 120, chromosome 21 open reading frame 62, hypothetical protein LOC56245, PRED81
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 56245
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype: IgG
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: NP_062542
Gene Symbols: C21ORF62
Immunogen: Synthetic peptide directed towards the middle region of human C21orf62. Peptide sequence STNTLPTEYLAICGLKRLRINMEAKHPFPEQSLLIHSGGDSDSREKPMWL.
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Human: 100%.
Target Species: Human, Rat
Form: __
Antigen: V5 Epitope Tag
Classification: Monoclonal
Conjugate: DyLight 755
Formulation: __
Gene Alias: V5 epitope tag
Host Species: Mouse
Purification Method: Protein A or G purified
Regulatory Status: RUO
Gene ID (Entrez): __
Reconstitution: __
Content And Storage: Store at 4C in the dark.
Isotype: IgG1
Applications: Western Blot, ELISA, Immunocytochemistry, Immunofluorescence
Concentration: __
Dilution: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence
Gene Accession No.: __
Gene Symbols: __
Immunogen: A recombinant peptide corresponding to the PK tag fused to a class II - restricted T helper cell epitope.
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Recognises a small epitope, termed Pk, present on the P/V proteins of the paramyxovirus, SV5.
Target Species: __
Form: Purified