CHMP4C Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP181166-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP181166 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
CHMP4C
Classification
Polyclonal
Dilution
Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Accession No.
Q96CF2
Gene Symbols
CHMP4C
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MSKLGKFFKGGGSSKSRAAPSPQEALVRLRETEEMLGKKQEYLENRIQREIALAKKHGTQN
Quantity
0.1 mL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
charged multivesicular body protein 4c, CHMP4c, chromatin modifying protein 4C, Chromatin-modifying protein 4c, hSnf7-3, hVps32-3, MGC22825, Shax3, SNF7 homolog associated with Alix 3, Snf7 homologue associated with Alix 3, SNF7-3, Vacuolar protein sorting-associated protein 32-3, Vps32-3, VPS32C
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
92421
Target Species
Human
Isotype
IgG
Related Products
Description
- CHMP4C Polyclonal specifically detects CHMP4C in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: CHMP4C
Classification: Polyclonal
Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Accession No.: Q96CF2
Gene Symbols: CHMP4C
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:MSKLGKFFKGGGSSKSRAAPSPQEALVRLRETEEMLGKKQEYLENRIQREIALAKKHGTQN
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: charged multivesicular body protein 4c, CHMP4c, chromatin modifying protein 4C, Chromatin-modifying protein 4c, hSnf7-3, hVps32-3, MGC22825, Shax3, SNF7 homolog associated with Alix 3, Snf7 homologue associated with Alix 3, SNF7-3, Vacuolar protein sorting-associated protein 32-3, Vps32-3, VPS32C
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 92421
Target Species: Human
Isotype: IgG
Antigen: ANKRD22
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200
Gene Accession No.: Q5VYY1
Gene Symbols: ANKRD22
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:KTKQNEALVRMLLDAGVEVNATDCYGCTALHYACEMKNPSLIPLLLEARADPTIKNKHGESSLDIARRLKFSQIELMLRK
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: ankyrin repeat domain 22, ankyrin repeat domain-containing protein 22, MGC22805
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 118932
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: QIVYIGDGGNDVCPVTFLKNDDVAMPRKGYTLQKTLSRMSQNLEPMEYSVVVWSSGVDIISHLQ
Quantity: 0.1mL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Gene ID (Entrez): 493911
Target Species: __
Isotype: __