POLR3GL Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP181997-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP181997 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
POLR3GL
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Gene Accession No.
Q9BT43
Gene Symbols
POLR3GL
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VGIGKGDALPPPTLQPSPLFPPLEFRPVPLPSGEEGEYVLALKQELRGAMRQLPYFIRPAVPKRDVERYSD
Quantity
0.1 mL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
alternative RNA polymerase III subunit 32, DNA-directed RNA polymerase III subunit G-like, DNA-directed RNA polymerase III subunit RPC7-like, flj32422, FLJ34890, MGC3200, polymerase (RNA) III (DNA directed) polypeptide G (32kD) like, polymerase (RNA) III (DNA directed) polypeptide G (32kD)-like, RNA polymerase III subunit C7-like, RPC32HOM, RPC32-like protein
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
84265
Target Species
Human
Isotype
IgG
Related Products
Description
- POLR3GL Polyclonal specifically detects POLR3GL in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: POLR3GL
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Gene Accession No.: Q9BT43
Gene Symbols: POLR3GL
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:VGIGKGDALPPPTLQPSPLFPPLEFRPVPLPSGEEGEYVLALKQELRGAMRQLPYFIRPAVPKRDVERYSD
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: alternative RNA polymerase III subunit 32, DNA-directed RNA polymerase III subunit G-like, DNA-directed RNA polymerase III subunit RPC7-like, flj32422, FLJ34890, MGC3200, polymerase (RNA) III (DNA directed) polypeptide G (32kD) like, polymerase (RNA) III (DNA directed) polypeptide G (32kD)-like, RNA polymerase III subunit C7-like, RPC32HOM, RPC32-like protein
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 84265
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: VGIGKGDALPPPTLQPSPLFPPLEFRPVPLPSGEEGEYVLALKQELRGAMRQLPYFIRPAVPKRDVERYSD
Quantity: 0.1mL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Gene ID (Entrez): 84265
Target Species: __
Isotype: __
Antigen: JSRP1
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500
Gene Accession No.: __
Gene Symbols: JSRP1
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:EAEVRPKIPGSREAAENDEEEPGEATGEAVREDRVTLADRGPKERPRREGKPRKEKPRKEERPKKERPRKEER
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: FLJ32416, JP45, JP-45homolog of mouse skeletal muscle sarcoplasmic reticulum protein JP-45, junctional sarcoplasmic reticulum protein 1,2310032K21Rik, Junctional-face membrane protein of 45 kDa homolog, skeletal muscle sarcoplasmic reticulum protein JP-45
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 126306
Target Species: Human
Isotype: IgG