CD3 epsilon Antibody (PPT3), Janelia Fluor™ 549, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP18225549-Each-of-1 | In Stock | ₹ 37,475.28 |
NBP18225549 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 37,475.28
GST (18%): ₹ 6,745.55
Total Price: ₹ 44,220.83
Antigen
CD3epsilon
Classification
Monoclonal
Conjugate
Janelia Fluor 549
Formulation
50mM Sodium Borate with 0.05% Sodium Azide
Gene Symbols
CD3E
Immunogen
Purified CD3 molecules from porcine thymus
Quantity
0.1 mL
Primary or Secondary
Primary
Test Specificity
Porcine CD3 epsilon, Mr 20 kDa
Content And Storage
Store at 4°C in the dark.
Isotype
IgG1 κ
Applications
Western Blot, Flow Cytometry, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen)
Clone
PPT3
Dilution
Western Blot, Flow Cytometry, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen
Gene Alias
CD3e antigen, CD3e antigen, epsilon polypeptide (TiT3 complex), CD3e molecule, epsilon (CD3-TCR complex), CD3-epsilon, FLJ18683, T3E, T-cell antigen receptor complex, epsilon subunit of T3, T-cell surface antigen T3/Leu-4 epsilon chain, T-cell surface glycoprotein CD3 epsilon chain, TCRE
Host Species
Mouse
Purification Method
Protein A or G purified
Research Discipline
Adaptive Immunity, Apoptosis, Cytokine Research, Diabetes Research, Immunology, Innate Immunity, Mesenchymal Stem Cell Markers, Signal Transduction, Stem Cell Lines, Stem Cell Markers
Gene ID (Entrez)
916
Target Species
Porcine
Form
Purified
Related Products
Description
- CD3 epsilon Monoclonal specifically detects CD3 epsilon in Porcine samples
- It is validated for Western Blot, Flow Cytometry, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.
Compare Similar Items
Show Difference
Antigen: CD3epsilon
Classification: Monoclonal
Conjugate: Janelia Fluor 549
Formulation: 50mM Sodium Borate with 0.05% Sodium Azide
Gene Symbols: CD3E
Immunogen: Purified CD3 molecules from porcine thymus
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Porcine CD3 epsilon, Mr 20 kDa
Content And Storage: Store at 4°C in the dark.
Isotype: IgG1 κ
Applications: Western Blot, Flow Cytometry, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen)
Clone: PPT3
Dilution: Western Blot, Flow Cytometry, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen
Gene Alias: CD3e antigen, CD3e antigen, epsilon polypeptide (TiT3 complex), CD3e molecule, epsilon (CD3-TCR complex), CD3-epsilon, FLJ18683, T3E, T-cell antigen receptor complex, epsilon subunit of T3, T-cell surface antigen T3/Leu-4 epsilon chain, T-cell surface glycoprotein CD3 epsilon chain, TCRE
Host Species: Mouse
Purification Method: Protein A or G purified
Research Discipline: Adaptive Immunity, Apoptosis, Cytokine Research, Diabetes Research, Immunology, Innate Immunity, Mesenchymal Stem Cell Markers, Signal Transduction, Stem Cell Lines, Stem Cell Markers
Gene ID (Entrez): 916
Target Species: Porcine
Form: Purified
Antigen: __
Classification: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: DATGVNADITITDIISGLGSNKWIQQNLQCLVLNSLTLSLEDPYERCFSRLSGLRALSITNVLFYNEDLAEVASLPRLESLDISNTSI
Quantity: 0.1mL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Isotype: __
Applications: __
Clone: __
Dilution: __
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Research Discipline: __
Gene ID (Entrez): 79699
Target Species: __
Form: __
Antigen: CD3epsilon
Classification: Monoclonal
Conjugate: Janelia Fluor 646
Formulation: 50mM Sodium Borate with 0.05% Sodium Azide
Gene Symbols: CD3E
Immunogen: Purified CD3 molecules from porcine thymus
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Porcine CD3 epsilon, Mr 20 kDa
Content And Storage: Store at 4°C in the dark.
Isotype: IgG1 κ
Applications: Western Blot, Flow Cytometry, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen)
Clone: PPT3
Dilution: Western Blot, Flow Cytometry, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen
Gene Alias: CD3e antigen, CD3e antigen, epsilon polypeptide (TiT3 complex), CD3e molecule, epsilon (CD3-TCR complex), CD3-epsilon, FLJ18683, T3E, T-cell antigen receptor complex, epsilon subunit of T3, T-cell surface antigen T3/Leu-4 epsilon chain, T-cell surface glycoprotein CD3 epsilon chain, TCRE
Host Species: Mouse
Purification Method: Protein A or G purified
Research Discipline: Adaptive Immunity, Apoptosis, Cytokine Research, Diabetes Research, Immunology, Innate Immunity, Mesenchymal Stem Cell Markers, Signal Transduction, Stem Cell Lines, Stem Cell Markers
Gene ID (Entrez): 916
Target Species: Porcine
Form: Purified