KLF3 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP182403-Each-of-1 | In Stock | ₹ 41,710.50 |
NBP182403 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
Antigen
KLF3
Classification
Polyclonal
Conjugate
Unconjugated
Formulation
PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias
Basic krueppel-like factor, basic Kruppel-like factor, BKLFbasic kruppel like factor, CACCC-box-binding protein BKLF, Krueppel-like factor 3, Kruppel-like factor 3 (basic), MGC48279, TEF-2
Host Species
Rabbit
Purification Method
Affinity purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Chicken: 92%; Zebrafish: 85%.
Target Species
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Zebrafish
Isotype
IgG
Applications
Western Blot
Concentration
0.5 mg/ml
Dilution
Western Blot 1.0 ug/ml
Gene Accession No.
NP_001099212
Gene Symbols
KLF3
Immunogen
Synthetic peptide towards Klf3. Peptide sequence WEGCTWKFARSDELTRHFRKHTGIKPFQCPDCDRSFSRSDHLALHRKRHM.
Quantity
100 μL
Research Discipline
DNA replication Transcription Translation and Splicing
Gene ID (Entrez)
51274
Reconstitution
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Related Products
Description
- KLF3 Polyclonal specifically detects KLF3 in Rat samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: KLF3
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: Basic krueppel-like factor, basic Kruppel-like factor, BKLFbasic kruppel like factor, CACCC-box-binding protein BKLF, Krueppel-like factor 3, Kruppel-like factor 3 (basic), MGC48279, TEF-2
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Chicken: 92%; Zebrafish: 85%.
Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Zebrafish
Isotype: IgG
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: NP_001099212
Gene Symbols: KLF3
Immunogen: Synthetic peptide towards Klf3. Peptide sequence WEGCTWKFARSDELTRHFRKHTGIKPFQCPDCDRSFSRSDHLALHRKRHM.
Quantity: 100 μL
Research Discipline: DNA replication Transcription Translation and Splicing
Gene ID (Entrez): 51274
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Antigen: KLF3
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS & 2% Sucrose. with No Preservative
Gene Alias: Basic krueppel-like factor, basic Kruppel-like factor, BKLFbasic kruppel like factor, CACCC-box-binding protein BKLF, Krueppel-like factor 3, Kruppel-like factor 3 (basic), MGC48279, TEF-2
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: __
Target Species: Rat
Isotype: IgG
Applications: Western Blot
Concentration: __
Dilution: Western Blot 1:1000
Gene Accession No.: NP_001099212
Gene Symbols: KLF3
Immunogen: Synthetic peptide towards Klf3. Peptide sequence WEGCTWKFARSDELTRHFRKHTGIKPFQCPDCDRSFSRSDHLALHRKRHM.
Quantity: 20 μL
Research Discipline: __
Gene ID (Entrez): 51274
Reconstitution: __
Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
Antigen: KLHL12/C3IP1
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: C3IP1kelch-like protein 12, CUL3-interacting protein 1, DKIR, FLJ27152, kelch-like 12 (Drosophila), kelch-like protein C3IP1
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: __
Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Isotype: IgG
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: NP_714952
Gene Symbols: KLHL12
Immunogen: Synthetic peptide towards C3IP1. Peptide sequence DIMTNTHAKSILNSMNSLRKSNTLCDVTLRVEQKDFPAHRIVLAACSDYF.
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 59349
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.