PDCD5 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP182656-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP182656 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
PDCD5
Classification
Polyclonal
Dilution
Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500-1:1000
Gene Alias
FLJ42784, MGC9294, programmed cell death 5, programmed cell death protein 5, Protein TFAR19, TF-1 cell apoptosis-related protein 19, TFAR19 novel apoptosis-related, TFAR19TF1 cell apoptosis-related gene 19
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols
PDCD5
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALV
Quantity
0.1 mL
Research Discipline
Apoptosis
Gene ID (Entrez)
9141
Target Species
Human
Isotype
IgG
Related Products
Description
- PDCD5 Polyclonal specifically detects PDCD5 in Human samples
- It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: PDCD5
Classification: Polyclonal
Dilution: Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500-1:1000
Gene Alias: FLJ42784, MGC9294, programmed cell death 5, programmed cell death protein 5, Protein TFAR19, TF-1 cell apoptosis-related protein 19, TFAR19 novel apoptosis-related, TFAR19TF1 cell apoptosis-related gene 19
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: PDCD5
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALV
Quantity: 0.1 mL
Research Discipline: Apoptosis
Gene ID (Entrez): 9141
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALV
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 9141
Target Species: __
Isotype: __
Antigen: NDUFA8
Classification: Polyclonal
Dilution: Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Alias: CI-19KD, CI-PGIV, complex I PGIV subunit, Complex I-19kD, Complex I-PGIV, MGC793, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8 (19kD, PGIV), NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8, 19kDa, NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8, NADH:ubiquinone oxidoreductase PGIV subunit, NADH-ubiquinone oxidoreductase 19 kDa subunit, PGIV
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry (Paraffin), Immunohistochemistry, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: NDUFA8
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:PGIVELPTLEELKVDEVKISSAVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNKCALDFFRQIKRHCA
Quantity: 0.1 mL
Research Discipline: __
Gene ID (Entrez): 4702
Target Species: Human, Rat
Isotype: IgG