MAT2B Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP182797-Each-of-1 | In Stock | ₹ 58,351.92 |
NBP182797 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 58,351.92
GST (18%): ₹ 10,503.346
Total Price: ₹ 68,855.266
Antigen
MAT2B
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Accession No.
Q9NZL9
Gene Symbols
MAT2B
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MFDKVQFSNKSANMDHWQQRFPTHVKDVATVCRQLAEKRMLDPSIKGTFHWSGNEQMTKYEMACAIADAFN
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
beta regulatory subunit of methionine adenosyltransferase, DTDP-4-keto-6-deoxy-D-glucose 4-reductase, MAT II beta, MAT-II, MATIIbeta, methionine adenosyltransferase 2 subunit beta, Methionine adenosyltransferase II beta, methionine adenosyltransferase II, beta, MGC12237, Nbla02999, putative protein product of Nbla02999, SDR23E1, short chain dehydrogenase/reductase family 23E, member 1, TGR
Host Species
Rabbit
Molecular Weight of Antigen
38 kDa
Quantity
0.1 mL
Research Discipline
Stem Cell Markers
Gene ID (Entrez)
27430
Target Species
Human, Rat
Isotype
IgG
Related Products
Description
- MAT2B Polyclonal specifically detects MAT2B in Human, Rat samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: MAT2B
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Accession No.: Q9NZL9
Gene Symbols: MAT2B
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:MFDKVQFSNKSANMDHWQQRFPTHVKDVATVCRQLAEKRMLDPSIKGTFHWSGNEQMTKYEMACAIADAFN
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: beta regulatory subunit of methionine adenosyltransferase, DTDP-4-keto-6-deoxy-D-glucose 4-reductase, MAT II beta, MAT-II, MATIIbeta, methionine adenosyltransferase 2 subunit beta, Methionine adenosyltransferase II beta, methionine adenosyltransferase II, beta, MGC12237, Nbla02999, putative protein product of Nbla02999, SDR23E1, short chain dehydrogenase/reductase family 23E, member 1, TGR
Host Species: Rabbit
Molecular Weight of Antigen: 38 kDa
Quantity: 0.1 mL
Research Discipline: Stem Cell Markers
Gene ID (Entrez): 27430
Target Species: Human, Rat
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: MFDKVQFSNKSANMDHWQQRFPTHVKDVATVCRQLAEKRMLDPSIKGTFHWSGNEQMTKYEMACAIADAFN
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Molecular Weight of Antigen: __
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 27430
Target Species: __
Isotype: __
Antigen: MAT2B
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:10-1:20
Gene Accession No.: __
Gene Symbols: MAT2B
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:AVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGEKAVLENNLGAAVLRIPILYGEVEKLEESAVTVM
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: beta regulatory subunit of methionine adenosyltransferase, DTDP-4-keto-6-deoxy-D-glucose 4-reductase, MAT II beta, MAT-II, MATIIbeta, methionine adenosyltransferase 2 subunit beta, Methionine adenosyltransferase II beta, methionine adenosyltransferase II, beta, MGC12237, Nbla02999, putative protein product of Nbla02999, SDR23E1, short chain dehydrogenase/reductase family 23E, member 1, TGR
Host Species: Rabbit
Molecular Weight of Antigen: __
Quantity: 0.1 mL
Research Discipline: Stem Cell Markers
Gene ID (Entrez): 27430
Target Species: Human
Isotype: IgG