ANO7 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP183099-Each-of-1 | In Stock | ₹ 57,494.00 |
NBP183099 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 57,494.00
GST (18%): ₹ 10,348.92
Total Price: ₹ 67,842.92
Antigen
ANO7
Classification
Polyclonal
Dilution
Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Accession No.
Q6IWH7
Gene Symbols
ANO7
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VRTGLYCRDQAHAERWAMTSETSSGSHCARSRMLRRRAQEEDSTVLIDVSPPEAEKRGSYGSTAHASEPGGQQ
Quantity
0.1 mL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
anoctamin 7, Dresden transmembrane protein of the prostate, IPCA-5IPCA5, New gene expressed in prostate, NGEPD-TMPP, PCANAP5anoctamin-7, PCANAP5L, prostate cancer associated protein 5, prostate cancer-associated gene 5, Prostate cancer-associated protein 5, TMEM16GDresden-transmembrane protein of the prostate, Transmembrane protein 16GDTMPP
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
50636
Target Species
Human
Isotype
IgG
Related Products
Description
- ANO7 Polyclonal specifically detects ANO7 in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: ANO7
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Accession No.: Q6IWH7
Gene Symbols: ANO7
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:VRTGLYCRDQAHAERWAMTSETSSGSHCARSRMLRRRAQEEDSTVLIDVSPPEAEKRGSYGSTAHASEPGGQQ
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: anoctamin 7, Dresden transmembrane protein of the prostate, IPCA-5IPCA5, New gene expressed in prostate, NGEPD-TMPP, PCANAP5anoctamin-7, PCANAP5L, prostate cancer associated protein 5, prostate cancer-associated gene 5, Prostate cancer-associated protein 5, TMEM16GDresden-transmembrane protein of the prostate, Transmembrane protein 16GDTMPP
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 50636
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: VRTGLYCRDQAHAERWAMTSETSSGSHCARSRMLRRRAQEEDSTVLIDVSPPEAEKRGSYGSTAHASEPGGQQ
Quantity: 0.1mL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Gene ID (Entrez): 50636
Target Species: __
Isotype: __
Antigen: STEAP2
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Accession No.: __
Gene Symbols: STEAP2
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:EYLASLFPDSLIVKGFNVVSAWALQLGPKDASRQVYICSNNIQARQQVIELARQLNFIPIDLGSLSSAREIE
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: EC 1.16.1, EC 1.16.1.-, IPCA1, metalloreductase STEAP2, PCANAP1STMP, prostate cancer associated protein 1, Prostate cancer-associated protein 1, Protein upregulated in metastatic prostate cancer, PUMPCn, six transmembrane epithelial antigen of prostate 2, six transmembrane epithelial antigen of the prostate 2, Six-transmembrane epithelial antigen of prostate 2, SixTransMembrane protein of prostate 1, STAMP1IPCA-1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 261729
Target Species: Human
Isotype: IgG