TAS2R42 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP183154-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP183154 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
TAS2R42
Classification
Polyclonal
Dilution
Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias
hT2R55, T2R24, T2R55T2R42, TAS2R55candidate taste receptor hT2R55, taste receptor T2R55, taste receptor type 2 member 42, Taste receptor type 2 member 55, taste receptor, type 2, member 42
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols
TAS2R42
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SLVRHTRNLKLSSLGSRDSSTEAHRRAMK
Quantity
0.1 mL
Research Discipline
GPCR
Gene ID (Entrez)
353164
Target Species
Human
Isotype
IgG
Related Products
Description
- TAS2R42 Polyclonal specifically detects TAS2R42 in Human samples
- It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: TAS2R42
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias: hT2R55, T2R24, T2R55T2R42, TAS2R55candidate taste receptor hT2R55, taste receptor T2R55, taste receptor type 2 member 42, Taste receptor type 2 member 55, taste receptor, type 2, member 42
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: TAS2R42
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:SLVRHTRNLKLSSLGSRDSSTEAHRRAMK
Quantity: 0.1 mL
Research Discipline: GPCR
Gene ID (Entrez): 353164
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: SLVRHTRNLKLSSLGSRDSSTEAHRRAMK
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 353164
Target Species: __
Isotype: __
Antigen: Semaphorin 6A
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Alias: KIAA1368HT018, SEMA, sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6A, Sema VIA, SEMA6A1, SEMA6A-1, semaphorin 6A-1, Semaphorin VIA, semaphorin-6A, Semaphorin-6A-1, SEMAQ, VIA
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: SEMA6A
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:RKDVAVVQRKEKELTHSRRGSMSSVTKLSGLFGDTQSKDPKPEAILTPLMHNGKLATPGNTAKMLIKADQHHLDLTAL
Quantity: 0.1 mL
Research Discipline: Apoptosis
Gene ID (Entrez): 57556
Target Species: Human
Isotype: IgG