CD300a/LMIR1 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP184431-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP184431 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
CD300a/LMIR1
Classification
Polyclonal
Dilution
Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Alias
CD300a antigenCMRF35H9, CD300a molecule, CLM-8, CMRF-35H, CMRF35-H, CMRF35H leukocyte immunoglobulin-like receptor, CMRF35-H9, CMRF-35-H9CD300 antigen-like family member A, CMRF35HIRp60, CMRF35-like molecule 8, IgSF12, IGSF12NK inhibitory receptor, Immunoglobulin superfamily member 12, Inhibitory receptor protein 60, IRC1, IRC1/IRC2, IRC2, Irp60, leukocyte membrane antigen
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols
CD300A
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SGDHSELSQNPKQASPREELHYASVVFDSNTNRIAAQRPREEEPDSDYSVIRK
Quantity
0.1 mL
Research Discipline
Mast Cell Markers
Gene ID (Entrez)
11314
Target Species
Human
Isotype
IgG
Related Products
Description
- CD300a/LMIR1 Polyclonal specifically detects CD300a/LMIR1 in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: CD300a/LMIR1
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Alias: CD300a antigenCMRF35H9, CD300a molecule, CLM-8, CMRF-35H, CMRF35-H, CMRF35H leukocyte immunoglobulin-like receptor, CMRF35-H9, CMRF-35-H9CD300 antigen-like family member A, CMRF35HIRp60, CMRF35-like molecule 8, IgSF12, IGSF12NK inhibitory receptor, Immunoglobulin superfamily member 12, Inhibitory receptor protein 60, IRC1, IRC1/IRC2, IRC2, Irp60, leukocyte membrane antigen
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: CD300A
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:SGDHSELSQNPKQASPREELHYASVVFDSNTNRIAAQRPREEEPDSDYSVIRK
Quantity: 0.1 mL
Research Discipline: Mast Cell Markers
Gene ID (Entrez): 11314
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: SGDHSELSQNPKQASPREELHYASVVFDSNTNRIAAQRPREEEPDSDYSVIRK
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 11314
Target Species: __
Isotype: __
Antigen: CD300c/LMIR2
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias: CD300c antigenCMRF35 antigen, CD300c molecule, CLM-6, CMRF-35, CMRF35 leukocyte immunoglobulin-like receptor, CMRF-35A, CMRF35A leukocyte immunoglobulin-like receptor, CMRF35ACMRF35A1, CMRF35CMRF35-A1, CMRF35-like molecule 6, IgSF16, IGSF16CD300 antigen-like family member C, Immunoglobulin superfamily member 16, LIR
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: CD300C
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:PWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVR
Quantity: 0.1 mL
Research Discipline: Immunology
Gene ID (Entrez): 10871
Target Species: Human
Isotype: IgG