CENPV Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP184546-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP184546 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
CENPV
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias
3110013H01Rik, CENP-VPRR6, centromere protein V, Nuclear protein p30, P30, proline rich 6, Proline-rich protein 6
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
201161
Target Species
Human, Mouse, Rat
Isotype
IgG
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols
CENPV
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HFIVPASRFKLLKGAEHITTYTFNTHKAQHTFCKRCGVQSFYTPRSNPGGFGIAPHCLDEGTVRSMV
Quantity
0.1 mL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- CENPV Polyclonal specifically detects CENPV in Human, Mouse, Rat samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: CENPV
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias: 3110013H01Rik, CENP-VPRR6, centromere protein V, Nuclear protein p30, P30, proline rich 6, Proline-rich protein 6
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 201161
Target Species: Human, Mouse, Rat
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: CENPV
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:HFIVPASRFKLLKGAEHITTYTFNTHKAQHTFCKRCGVQSFYTPRSNPGGFGIAPHCLDEGTVRSMV
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: Centrin 3
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:500-1:1000
Gene Alias: CDC31 yeast homolog, CEN3centrin, EF-hand protein, 3 (CDC31 homolog, yeast), centrin, EF-hand protein, 3, centrin, EF-hand protein, 3 (CDC31 yeast homolog), centrin-3, EF-hand superfamily member, MGC12502, MGC138245
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 1070
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: CETN3
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:AMRALGFDVKKADVLKILKDYDREATGKITFEDFNEVVTDWILERDPHEEILK
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Gene ID (Entrez): 1070
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: AMRALGFDVKKADVLKILKDYDREATGKITFEDFNEVVTDWILERDPHEEILK
Quantity: 0.1mL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.