Histone Deacetylase 2/HDAC2 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP187109-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP187109 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
Histone Deacetylase 2/HDAC2
Classification
Polyclonal
Dilution
Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50, Knockdown Validated
Gene Accession No.
Q92769
Gene Symbols
HDAC2
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNP
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
EC 3.5.1.98, HD2, histone deacetylase 2, RPD3, transcriptional regulator homolog RPD3, YAF1, YY1-associated factor 1
Host Species
Rabbit
Molecular Weight of Antigen
55 kDa
Quantity
0.1 mL
Research Discipline
Breast Cancer, Cancer, Chromatin Research, Epigenetics, Histone Deacetylases, Stem Cell Markers
Gene ID (Entrez)
3066
Target Species
Human, Mouse, Rat
Isotype
IgG
Related Products
Description
- Histone Deacetylase 2/HDAC2 Polyclonal specifically detects Histone Deacetylase 2/HDAC2 in Human, Mouse samples
- It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.
Compare Similar Items
Show Difference
Antigen: Histone Deacetylase 2/HDAC2
Classification: Polyclonal
Dilution: Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50, Knockdown Validated
Gene Accession No.: Q92769
Gene Symbols: HDAC2
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:IACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNP
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: EC 3.5.1.98, HD2, histone deacetylase 2, RPD3, transcriptional regulator homolog RPD3, YAF1, YY1-associated factor 1
Host Species: Rabbit
Molecular Weight of Antigen: 55 kDa
Quantity: 0.1 mL
Research Discipline: Breast Cancer, Cancer, Chromatin Research, Epigenetics, Histone Deacetylases, Stem Cell Markers
Gene ID (Entrez): 3066
Target Species: Human, Mouse, Rat
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: IACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNP
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Molecular Weight of Antigen: __
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 3066
Target Species: __
Isotype: __
Antigen: RPC62
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Accession No.: __
Gene Symbols: POLR3C
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:QHFRDQAIVSAVANRMDQTSSEIVRTMLRMSEITTSSSAPFTQPLSSNEIFRSLPVGYNISKQVLDQYLTLLADDPLEFVGKSG
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of human RPC62 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: DNA-directed III 62 kDa polypeptide, DNA-directed RNA polymerase III subunit C, DNA-directed RNA polymerase III subunit RPC3, polymerase (RNA) III (DNA directed) polypeptide C (62kD), RNA polymerase III 62 kDa subunit, RNA polymerase III subunit C3, RPC62RPC3
Host Species: Rabbit
Molecular Weight of Antigen: __
Quantity: 0.1 mL
Research Discipline: __
Gene ID (Entrez): 10623
Target Species: Human, Mouse, Rat
Isotype: IgG