PP2C gamma/PPM1G Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP187245-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP187245 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
PP2C gamma/PPM1G
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500
Gene Alias
EC 3.1.3.16, MGC1675, MGC2870, PP2C, gamma, PP2CG, PP2C-gamma, PP2CGAMMA, PPM1C, PPP2CG, Protein phosphatase 1C, protein phosphatase 1G, protein phosphatase 1G (formerly 2C), magnesium-dependent, gamma isoform, protein phosphatase 2, catalytic subunit, gamma isoform, protein phosphatase 2C gamma isoform, Protein phosphatase 2C isoform gamma, Protein phosphatase magnesium-dependent 1 gamma, protein phosphatase, Mg2+/Mn2+ dependent, 1G
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols
PPM1G
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LYCAKYLPDIIKDQKAYKEGKLQKALEDAFLAIDAKLTTEEVIKELAQIAGRPTEDEDEKEKVADEDDVD
Quantity
0.1 mL
Research Discipline
Cell Cycle and Replication, Core ESC Like Genes, Stem Cell Markers
Gene ID (Entrez)
5496
Target Species
Human, Mouse, Rat
Isotype
IgG
Description
- PP2C gamma/PPM1G Polyclonal specifically detects PP2C gamma/PPM1G in Human, Mouse, Rat samples
- It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: PP2C gamma/PPM1G
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500
Gene Alias: EC 3.1.3.16, MGC1675, MGC2870, PP2C, gamma, PP2CG, PP2C-gamma, PP2CGAMMA, PPM1C, PPP2CG, Protein phosphatase 1C, protein phosphatase 1G, protein phosphatase 1G (formerly 2C), magnesium-dependent, gamma isoform, protein phosphatase 2, catalytic subunit, gamma isoform, protein phosphatase 2C gamma isoform, Protein phosphatase 2C isoform gamma, Protein phosphatase magnesium-dependent 1 gamma, protein phosphatase, Mg2+/Mn2+ dependent, 1G
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: PPM1G
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:LYCAKYLPDIIKDQKAYKEGKLQKALEDAFLAIDAKLTTEEVIKELAQIAGRPTEDEDEKEKVADEDDVD
Quantity: 0.1 mL
Research Discipline: Cell Cycle and Replication, Core ESC Like Genes, Stem Cell Markers
Gene ID (Entrez): 5496
Target Species: Human, Mouse, Rat
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: LYCAKYLPDIIKDQKAYKEGKLQKALEDAFLAIDAKLTTEEVIKELAQIAGRPTEDEDEKEKVADEDDVD
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 5496
Target Species: __
Isotype: __
Antigen: PP2C epsilon/PPM1L
Classification: Polyclonal
Dilution: Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Alias: EC 3.1.3, EC 3.1.3.16, MGC132545, MGC132547, PP2C epsilon, PP2CEProtein phosphatase 2C isoform epsilon, PP2C-epsilon, PPM1-LIKE, protein phosphatase 1 (formerly 2C)-like, protein phosphatase 1L, Protein phosphatase 1-like, Protein phosphatase 2C epsilon isoform, protein phosphatase, Mg2+/Mn2+ dependent, 1L
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: PPM1L
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:DLDKLQPEFMILASDGLWDAFSNEEAVRFIKERLDEPHFGAKSIVLQSFYRGCPDNITVMVVKFRNSSK
Quantity: 0.1 mL
Research Discipline: Protein Phosphatase
Gene ID (Entrez): 151742
Target Species: Human
Isotype: IgG