CIP29 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP188084-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP188084 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
CIP29
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Alias
CIP29Hcc-1, cytokine induced protein 29 kDa, Cytokine-induced protein of 29 kDa, HCC1MGC14726, hepatocellular carcinoma 1, HSPC316, Nuclear protein Hcc-1, proliferation associated cytokine-inducible protein CIP29, Proliferation-associated cytokine-inducible protein CIP29, SAP domain containing ribonucleoprotein, SAP domain-containing ribonucleoprotein, THO1
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
84324
Target Species
Human, Mouse, Rat
Isotype
IgG
Applications
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols
SARNP
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SSDNKPMVNLDKLKERAQRFGLNVSSISRKSEDDEKLKKRKERFGIVTSSAGTGTTEDTEAKKRKRAERFGIA
Quantity
0.1 mL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- CIP29 Polyclonal specifically detects CIP29 in Human, Mouse, Rat samples
- It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: CIP29
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Alias: CIP29Hcc-1, cytokine induced protein 29 kDa, Cytokine-induced protein of 29 kDa, HCC1MGC14726, hepatocellular carcinoma 1, HSPC316, Nuclear protein Hcc-1, proliferation associated cytokine-inducible protein CIP29, Proliferation-associated cytokine-inducible protein CIP29, SAP domain containing ribonucleoprotein, SAP domain-containing ribonucleoprotein, THO1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 84324
Target Species: Human, Mouse, Rat
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: SARNP
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:SSDNKPMVNLDKLKERAQRFGLNVSSISRKSEDDEKLKKRKERFGIVTSSAGTGTTEDTEAKKRKRAERFGIA
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Gene ID (Entrez): 84324
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: SSDNKPMVNLDKLKERAQRFGLNVSSISRKSEDDEKLKKRKERFGIVTSSAGTGTTEDTEAKKRKRAERFGIA
Quantity: 0.1mL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Antigen: CHTOP
Classification: Polyclonal
Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias: C1orf77, chromatin target of PRMT1, DKFZp547E1010, FOPMGC86949, Friend of PRMT1 protein, MGC131924, pp7704, RP1-178F15.2, Small arginine- and glycine-rich protein, small protein rich in arginine and glycine, SRAGchromosome 1 open reading frame 77
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 26097
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: CHTOP
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:GRGRGMIGRGRGGFGGRGRGRGRGRGALARPVLTKEQLDNQLDAYMSKTKGHLDAELDAYMAQTDPETND
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
