OTUD7B/Cezanne/ZA20D1 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP188095-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP188095 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
OTUD7B/Cezanne/ZA20D1
Classification
Polyclonal
Dilution
Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias
cellular zinc finger NF-kappaB Cezanne, Cellular zinc finger NF-kappa-B protein, CEZANNEA20 domain containing 1, EC 3.4.19.12, OTU domain containing 7B, OTU domain-containing protein 7B, ZA20D1, Zinc finger A20 domain-containing protein 1, Zinc finger protein Cezanne
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of human OTUD7B/Cezanne/ZA20D1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols
OTUD7B
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PHQDSIPSLEPGSHSKDGLHRGALLPPPYRVADSYSNGYREPPEPDGWAGGLRGLPPTQTKCKQPNCSFYG
Quantity
0.1 mL
Research Discipline
Mucosal Immunology
Gene ID (Entrez)
56957
Target Species
Human, Mouse, Rat
Isotype
IgG
Related Products
Description
- OTUD7B/Cezanne/ZA20D1 Polyclonal specifically detects OTUD7B/Cezanne/ZA20D1 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: OTUD7B/Cezanne/ZA20D1
Classification: Polyclonal
Dilution: Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias: cellular zinc finger NF-kappaB Cezanne, Cellular zinc finger NF-kappa-B protein, CEZANNEA20 domain containing 1, EC 3.4.19.12, OTU domain containing 7B, OTU domain-containing protein 7B, ZA20D1, Zinc finger A20 domain-containing protein 1, Zinc finger protein Cezanne
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of human OTUD7B/Cezanne/ZA20D1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: OTUD7B
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:PHQDSIPSLEPGSHSKDGLHRGALLPPPYRVADSYSNGYREPPEPDGWAGGLRGLPPTQTKCKQPNCSFYG
Quantity: 0.1 mL
Research Discipline: Mucosal Immunology
Gene ID (Entrez): 56957
Target Species: Human, Mouse, Rat
Isotype: IgG
Antigen: GPER/GPR30
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias: CEPRG-protein coupled receptor 30, Chemoattractant receptor-like 2, chemokine receptor-like 2, CMKRL2MGC99678, constitutively expressed peptide-like receptor, DRY12IL8-related receptor DRY12, FEG-1mER, Flow-induced endothelial G-protein coupled receptor 1, G protein-coupled estrogen receptor 1, G protein-coupled receptor 30, GPCR-BR, GPR30GPCR-Br, G-protein coupled estrogen receptor 1, heptahelix receptor, LERGU, LERGU2, leucine rich protein in GPR30 3'UTR, LyGPR, Lymphocyte-derived G-protein coupled receptor, Membrane estrogen receptor
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: GPER1
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:MDVTSQARGVGLEMYPGTAQPAAPNTTSPELNLSHPLLGTALANGTGELSEHQQYVIGLFLS
Quantity: 0.1 mL
Research Discipline: Breast Cancer, Cancer, GPCR, Neuroscience
Gene ID (Entrez): 2852
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: PKQTEGFRKRWFTMDDRRLMYFKDPLDAFARGEVFIGSKESGYTVLHGFPPSTQGHHWPHGITIVTPDRKFLFACETESDQREWVAAFQKAVDRPMLPQEYAVE
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 11033
Target Species: __
Isotype: __