BRI3BP Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP188564-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP188564 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
BRI3BP
Classification
Polyclonal
Dilution
Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Alias
BNAS1, BRI3 binding protein, BRI3-binding protein, Cervical cancer 1 proto-oncogene-binding protein KG19, cervical cancer oncogene binding protein, HCCR-1, HCCR-2, HCCRBP-1, KG19I3-binding protein
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
140707
Target Species
Human
Isotype
IgG
Applications
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols
BRI3BP
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MFVETLWKVWTELLDVLGLDVSNLSQYFSPASVSSSPARALLLVGVV
Quantity
0.1 mL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- BRI3BP Polyclonal specifically detects BRI3BP in Human samples
- It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: BRI3BP
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Alias: BNAS1, BRI3 binding protein, BRI3-binding protein, Cervical cancer 1 proto-oncogene-binding protein KG19, cervical cancer oncogene binding protein, HCCR-1, HCCR-2, HCCRBP-1, KG19I3-binding protein
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 140707
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: BRI3BP
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:MFVETLWKVWTELLDVLGLDVSNLSQYFSPASVSSSPARALLLVGVV
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Gene ID (Entrez): 140707
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: MFVETLWKVWTELLDVLGLDVSNLSQYFSPASVSSSPARALLLVGVV
Quantity: 0.1mL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Antigen: CCR6
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias: BN-1, CC-CKR-6, CCR-6, CD196 antigen, chemokine (C-C motif) receptor 6, CKR-L3G-protein coupled receptor 29, CKRL3LARC receptor, CMKBR6STRL22, DRY6, GPR29C-C CKR-6, GPRCY4DRY-6, lymphocyte, 22
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 1235
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: CCR6
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:KYNTQGSDVCEPKYQTVSEPIRWKLLML
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.