DTD1 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP188776-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP188776 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
DTD1
Classification
Polyclonal
Dilution
Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias
bA379J5.3, bA555E18.1, C20orf88HARS2, chromosome 20 open reading frame 88, DNA-unwinding element-binding protein, D-tyrosyl-tRNA deacylase 1 homolog (S. cerevisiae), D-tyrosyl-tRNA(Tyr) deacylase 1, DUEB, EC 3.1, Histidyl-tRNA synthase-related, histidyl-tRNA synthetase 2, MGC119131, MGC41905, pqn-68
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols
DTD1
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SVTVGGEQISAIGRGICVLLGISLEDTQKELEHMVRKILNLRVFEDESGKHWSKSVMDKQYEILCVSQFT
Quantity
0.1 mL
Research Discipline
DNA replication Transcription Translation and Splicing
Gene ID (Entrez)
92675
Target Species
Human
Isotype
IgG
Related Products
Description
- DTD1 Polyclonal specifically detects DTD1 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: DTD1
Classification: Polyclonal
Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias: bA379J5.3, bA555E18.1, C20orf88HARS2, chromosome 20 open reading frame 88, DNA-unwinding element-binding protein, D-tyrosyl-tRNA deacylase 1 homolog (S. cerevisiae), D-tyrosyl-tRNA(Tyr) deacylase 1, DUEB, EC 3.1, Histidyl-tRNA synthase-related, histidyl-tRNA synthetase 2, MGC119131, MGC41905, pqn-68
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: DTD1
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:SVTVGGEQISAIGRGICVLLGISLEDTQKELEHMVRKILNLRVFEDESGKHWSKSVMDKQYEILCVSQFT
Quantity: 0.1 mL
Research Discipline: DNA replication Transcription Translation and Splicing
Gene ID (Entrez): 92675
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: SVTVGGEQISAIGRGICVLLGISLEDTQKELEHMVRKILNLRVFEDESGKHWSKSVMDKQYEILCVSQFT
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 92675
Target Species: __
Isotype: __
Antigen: bcl10-interacting CARD protein
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Alias: bA370F5.1, bcl10-interacting CARD protein, Bcl10-interacting protein with CARD, BinCARD, chromosome 9 open reading frame 89, MGC110898, MGC11115
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: CARD19
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:PKGLPGTRRVLGFSPVIIDRHVSRYLLAFLADDLG
Quantity: 0.1 mL
Research Discipline: Protein Kinase
Gene ID (Entrez): 84270
Target Species: Human
Isotype: IgG