AUF1 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP188915-Each-of-1 | In Stock | ₹ 55,485.66 |
NBP188915 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,485.66
GST (18%): ₹ 9,987.419
Total Price: ₹ 65,473.079
Antigen
AUF1
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500
Gene Alias
AUF1A, heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein1, 37kDa), heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA-binding protein1, 37kD), heterogeneous nuclear ribonucleoprotein D0, hnRNPD0, type A
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
3184
Target Species
Human
Isotype
IgG
Applications
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols
HNRNPD
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGDQQSGYGKVS
Quantity
0.1 mL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- AUF1 Polyclonal specifically detects AUF1 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: AUF1
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500
Gene Alias: AUF1A, heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein1, 37kDa), heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA-binding protein1, 37kD), heterogeneous nuclear ribonucleoprotein D0, hnRNPD0, type A
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 3184
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: HNRNPD
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:RGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGDQQSGYGKVS
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Gene ID (Entrez): 3184
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: RGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGDQQSGYGKVS
Quantity: 0.1mL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Antigen: CRELD1
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias: atrioventricular septal defect 2, AVSD2, CIRRIN, cysteine-rich with EGF-like domain protein 1, cysteine-rich with EGF-like domains 1, DKFZp566D213
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 78987
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: CRELD1
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:GAFPILTDLTPETTRRWKLGSHPHSTYVKMKMQRDEATFPGLYGKQVAKLGSQSRQSDRGTRL
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.