FoxC1 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP189025-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP189025 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
FoxC1
Classification
Polyclonal
Dilution
Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias
ARA, FKHL7RIEG3, forkhead box C1, forkhead box protein C1, forkhead, drosophila, homolog-like 7, forkhead/winged helix-like transcription factor 7, forkhead-related activator 3, Forkhead-related protein FKHL7, Forkhead-related transcription factor 3, FREAC-3, FREAC3IRID1, IGDA, IHG1, myeloid factor-delta
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols
FOXC1
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YPGQQQNFHSVREMFESQRIGLNNSPVNGNSSCQMAFPSSQSLYRTSGAFVYDCSKF
Quantity
0.1 mL
Research Discipline
Cancer
Gene ID (Entrez)
2296
Target Species
Human
Isotype
IgG
Related Products
Description
- FoxC1 Polyclonal specifically detects FoxC1 in Human samples
- It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: FoxC1
Classification: Polyclonal
Dilution: Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias: ARA, FKHL7RIEG3, forkhead box C1, forkhead box protein C1, forkhead, drosophila, homolog-like 7, forkhead/winged helix-like transcription factor 7, forkhead-related activator 3, Forkhead-related protein FKHL7, Forkhead-related transcription factor 3, FREAC-3, FREAC3IRID1, IGDA, IHG1, myeloid factor-delta
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: FOXC1
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:YPGQQQNFHSVREMFESQRIGLNNSPVNGNSSCQMAFPSSQSLYRTSGAFVYDCSKF
Quantity: 0.1 mL
Research Discipline: Cancer
Gene ID (Entrez): 2296
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: YPGQQQNFHSVREMFESQRIGLNNSPVNGNSSCQMAFPSSQSLYRTSGAFVYDCSKF
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 2296
Target Species: __
Isotype: __
Antigen: APLP-2
Classification: Polyclonal
Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias: amyloid beta (A4) precursor-like protein 2, amyloid precursor protein homolog HSD-2, Amyloid protein homolog, amyloid-like protein 2, APLP-2, APPHCDEI box-binding protein, APPL2, CDEBP
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: APLP2
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:PYVAQEIQEEIDELLQEQRADMDQFTASISETPVDVRVSSEESEEIPPFHPFHPFPALPENEDTQPELYHPMK
Quantity: 0.1 mL
Research Discipline: Signal Transduction
Gene ID (Entrez): 334
Target Species: Human, Mouse
Isotype: IgG