AMSH-LP Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP189135-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP189135 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
AMSH-LP
Classification
Polyclonal
Dilution
Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Accession No.
Q96FJ0
Gene Symbols
STAMBPL1
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LKKYNVEYQEYLQSKNKYKAEILKKLEHQRLIEAERKRIAQMRQQQLESEQFLFFEDQLKKQELARGQMRSQQTSGLS
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of human AMSH-LP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
ALMalpha, AMSH-FP, AMSHLP, AMSH-LPassociated molecule with the SH3 domain of STAM (AMSH) - Family Protein, associated molecule with the SH3 domain of STAM (AMSH) like protein, bA399O19.2, EC 3.1.2.15, EC 3.4.19.-, FLJ31524, KIAA1373AMSH-like protease, STAM binding protein-like 1, STAM-binding protein-like 1
Host Species
Rabbit
Molecular Weight of Antigen
50 kDa
Quantity
0.1 mL
Research Discipline
DNA replication Transcription Translation and Splicing
Gene ID (Entrez)
57559
Target Species
Human
Isotype
IgG
Related Products
Description
- AMSH-LP Polyclonal specifically detects AMSH-LP in Human samples
- It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: AMSH-LP
Classification: Polyclonal
Dilution: Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Accession No.: Q96FJ0
Gene Symbols: STAMBPL1
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:LKKYNVEYQEYLQSKNKYKAEILKKLEHQRLIEAERKRIAQMRQQQLESEQFLFFEDQLKKQELARGQMRSQQTSGLS
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of human AMSH-LP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: ALMalpha, AMSH-FP, AMSHLP, AMSH-LPassociated molecule with the SH3 domain of STAM (AMSH) - Family Protein, associated molecule with the SH3 domain of STAM (AMSH) like protein, bA399O19.2, EC 3.1.2.15, EC 3.4.19.-, FLJ31524, KIAA1373AMSH-like protease, STAM binding protein-like 1, STAM-binding protein-like 1
Host Species: Rabbit
Molecular Weight of Antigen: 50 kDa
Quantity: 0.1 mL
Research Discipline: DNA replication Transcription Translation and Splicing
Gene ID (Entrez): 57559
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: VDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQTLLAKEKKSYDRQRW
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Molecular Weight of Antigen: __
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 613
Target Species: __
Isotype: __
Antigen: ENPP-7/Alk-SMase
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Accession No.: __
Gene Symbols: ENPP7
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:LEVEPFESVHVYELMCRLLGIVPEANDGHLATLLPMLHTESALPPDGRPTLLPKGRSALPPSSRPLLVMGLLGTVILLSE
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: Alkaline sphingomyelin phosphodiesterase, alkaline sphingomyelinase, ALK-SMase, EC 3.1.4.12, ectonucleotide pyrophosphatase/phosphodiesterase 7, ectonucleotide pyrophosphatase/phosphodiesterase family member 7, E-NPP 7, Intestinal alkaline sphingomyelinase, MGC50179, NPP-7
Host Species: Rabbit
Molecular Weight of Antigen: __
Quantity: 0.1 mL
Research Discipline: Lipid and Metabolism
Gene ID (Entrez): 339221
Target Species: Human
Isotype: IgG