Manufacturer: Novus Biologicals
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP189333-Each-of-1 | In Stock | ₹ 53,988.36 |
NBP189333 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,988.36
GST (18%): ₹ 9,717.905
Total Price: ₹ 63,706.265
TCIRG1
Polyclonal
Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
a3, Atp6i, ATP6N1Cspecific 116-kDa vacuolar proton pump subunit, ATP6V0A3T-cell immune response cDNA 7, OC-116, OC-116 kDa, OC-116kDa, OC116Vph1, OPTB1, Osteoclastic proton pump 116 kDa subunit, Stv1, T-cell immune regulator 1, T-cell immune response cDNA7 protein, T-cell, immune regulator 1, T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 protein a, T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 protein A3, T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 protein aisoform 3, T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 subunit A3, TIRC7ATPase, H+ transporting, 116kD, vacuolar proton translocating ATPase 116 kDa subunit A, Vacuolar proton translocating ATPase 116 kDa subunit a isoform 3, V-ATPase 116 kDa isoform a3, V-ATPase 116-kDa, V-type proton ATPase 116 kDa subunit a, V-type proton ATPase 116 kDa subunit a isoform 3
Rabbit
Affinity Purified
RUO
10312
Human, Mouse
IgG
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
TCIRG1
This antibody was developed against Recombinant Protein corresponding to amino acids:RPADRQEENKAGLLDLPDASVNGWSSDEEKAGGLDDEEEAELVPSEVLMHQAIHTI
0.1 mL
Primary
Specificity of human TCIRG1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.