GFR alpha-2/GDNF R alpha-2 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP189778-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP189778 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
GFR alpha-2/GDNF R alpha-2
Classification
Polyclonal
Dilution
Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Alias
GDNF family receptor alpha 2, GDNF family receptor alpha-2, GDNF receptor alpha-2, GDNF receptor beta, GDNFR-alpha-2, GDNFR-beta, GDNFRBRET ligand 2, GFR-alpha 2, GFR-alpha-2, glial cell line derived neurotrophic factor receptor, beta, Neurturin receptor alpha, NRTNR-alpha, NTNRA, NTNR-alpha, PI-linked cell-surface accessory protein, RETL2TGF-beta-related neurotrophic factor receptor 2, TGF-beta related neurotrophic factor receptor 2, TRN receptor, GPI-anchored, TRNR2NRTNR-ALPHA
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
2675
Target Species
Human
Isotype
IgG
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols
GFRA2
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SPSSLQGPELHGWRPPVDCVRANELCAAESNCSSRYRTLRQCLAGRDRNTMLANKECQAALEVLQESPLYDCR
Quantity
0.1 mL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- GFR alpha-2/GDNF R alpha-2 Polyclonal specifically detects GFR alpha-2/GDNF R alpha-2 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: GFR alpha-2/GDNF R alpha-2
Classification: Polyclonal
Dilution: Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Alias: GDNF family receptor alpha 2, GDNF family receptor alpha-2, GDNF receptor alpha-2, GDNF receptor beta, GDNFR-alpha-2, GDNFR-beta, GDNFRBRET ligand 2, GFR-alpha 2, GFR-alpha-2, glial cell line derived neurotrophic factor receptor, beta, Neurturin receptor alpha, NRTNR-alpha, NTNRA, NTNR-alpha, PI-linked cell-surface accessory protein, RETL2TGF-beta-related neurotrophic factor receptor 2, TGF-beta related neurotrophic factor receptor 2, TRN receptor, GPI-anchored, TRNR2NRTNR-ALPHA
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 2675
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: GFRA2
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:SPSSLQGPELHGWRPPVDCVRANELCAAESNCSSRYRTLRQCLAGRDRNTMLANKECQAALEVLQESPLYDCR
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Gene ID (Entrez): 2675
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: SPSSLQGPELHGWRPPVDCVRANELCAAESNCSSRYRTLRQCLAGRDRNTMLANKECQAALEVLQESPLYDCR
Quantity: 0.1mL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Antigen: PP14/Glycodelin
Classification: Polyclonal
Dilution: Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Gene Alias: alpha uterine protein, GdF, GdS, glycodelin, glycodelin-A, glycodelin-F, glycodelin-S, MGC138509, MGC142288, PEP, Placental protein 14, PP14 protein (placental protein 14), PP14GDPAEGGdA, pregnancy-associated endometrial a, Pregnancy-associated endometrial alpha-2 globulin, pregnancy-associated endometrial alpha-2-globulin, progestagen-associated endometrial protein (placental protein 14, progestagen-associated endometrial proteinPEG, Progesterone-associated endometrial protein
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 5047
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: PAEP
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:QDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKI
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.