AKR1CL2 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP190195-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP190195 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
AKR1CL2
Classification
Polyclonal
Dilution
Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Gene Accession No.
Q96JD6
Gene Symbols
AKR1E2
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MGFKPPHPEWIMSCSELSFCLSHPRVQDLPLDESNMVIPSDTDFLDTWEAMEDLVITGLVKNIG
Quantity
0.1 mL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
AF reductase, AKR1CL2, AKRDC1, Aldo-keto reductase family 1 member C-like protein 21,5-anhydro-D-fructose reductase, Aldo-keto reductase family 1 member E2, aldo-keto reductase family 1, member C-like 2, aldo-keto reductase family 1, member E2, aldo-keto reductase loopADR, aldo-keto reductase related protein, EC 1.1.1, EC 1.1.1.263, hTSP, LoopADR, MGC10612, Testis-specific protein
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
83592
Target Species
Human
Isotype
IgG
Related Products
Description
- AKR1CL2 Polyclonal specifically detects AKR1CL2 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: AKR1CL2
Classification: Polyclonal
Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Gene Accession No.: Q96JD6
Gene Symbols: AKR1E2
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:MGFKPPHPEWIMSCSELSFCLSHPRVQDLPLDESNMVIPSDTDFLDTWEAMEDLVITGLVKNIG
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: AF reductase, AKR1CL2, AKRDC1, Aldo-keto reductase family 1 member C-like protein 21,5-anhydro-D-fructose reductase, Aldo-keto reductase family 1 member E2, aldo-keto reductase family 1, member C-like 2, aldo-keto reductase family 1, member E2, aldo-keto reductase loopADR, aldo-keto reductase related protein, EC 1.1.1, EC 1.1.1.263, hTSP, LoopADR, MGC10612, Testis-specific protein
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 83592
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: PEMEGDDNLGGEDKKETPEEVAADVLAEVITAAVRAVDGEGAPAPESSGEPAEDEGPTDTAEAGSDPQAEQLLEEQVPCGTAHEKGVPKARSEAAEAGNGAETMAAEAESAQTRVAPAPAAADAEVEQTDAESKDAVP
Quantity: 0.1mL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Gene ID (Entrez): 10270
Target Species: __
Isotype: __
Antigen: ADK
Classification: Polyclonal
Dilution: Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500
Gene Accession No.: __
Gene Symbols: ADK
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:LFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAEDKHKELFDELVKKFKVEYHAGGSTQNSIKVAQWMIQQPHK
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: adenosine kinase, AKAdenosine 5'-phosphotransferase, EC 2.7.1, EC 2.7.1.20
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 132
Target Species: Human, Mouse, Rat
Isotype: IgG