DNAH12 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP190586-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP190586 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
DNAH12
Classification
Polyclonal
Dilution
Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Alias
axonemal beta dynein heavy chain 12, axonemal dynein heavy chain isotype3, axonemal, heavy polypeptide 12, ciliary dynein heavy chain 12, DHC3, DLP12, DNAH12L, DNAH7L, DNAHC12, DNAHC3, DNHD2, dynein heavy chain 12, axonemal, dynein heavy chain domain-containing protein 2, dynein, axonemal, heavy chain 12, dynein, heavy chain-5, FLJ40427, FLJ44290, HDHC3, HL19, HL-19
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
201625
Target Species
Human
Isotype
IgG
Applications
Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols
DNAH12
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IHGLYLDGARWDRESGLLAEQYPKLLFDLMPIIWIKPTQKSRIIKSDAYVCP
Quantity
0.1 mL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- DNAH12 Polyclonal specifically detects DNAH12 in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: DNAH12
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Alias: axonemal beta dynein heavy chain 12, axonemal dynein heavy chain isotype3, axonemal, heavy polypeptide 12, ciliary dynein heavy chain 12, DHC3, DLP12, DNAH12L, DNAH7L, DNAHC12, DNAHC3, DNHD2, dynein heavy chain 12, axonemal, dynein heavy chain domain-containing protein 2, dynein, axonemal, heavy chain 12, dynein, heavy chain-5, FLJ40427, FLJ44290, HDHC3, HL19, HL-19
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 201625
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: DNAH12
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:IHGLYLDGARWDRESGLLAEQYPKLLFDLMPIIWIKPTQKSRIIKSDAYVCP
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Gene ID (Entrez): 201625
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: IHGLYLDGARWDRESGLLAEQYPKLLFDLMPIIWIKPTQKSRIIKSDAYVCP
Quantity: 0.1mL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Antigen: espin
Classification: Polyclonal
Dilution: Western Blot 0.04 - 0.4 ug/ml, Simple Western 1:20, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Alias: autosomal recessive deafness type 36 protein, DKFZp434A196, DKFZp434G2126, espin
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 83715
Target Species: Human, Rat
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: ESPN
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:SMPAWRRDLLRKKLEEEREQKRKEEERQKQEELRREKEQSEKLRTLGYDESKLAPWQRQVILKK
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of human espin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.