MBD4 Antibody, Alexa Fluor™ 700, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP191189Z-Each-of-1 | In Stock | ₹ 53,218.32 |
NBP191189Z - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,218.32
GST (18%): ₹ 9,579.298
Total Price: ₹ 62,797.618
Antigen
MBD4
Classification
Polyclonal
Dilution
Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Western Blot (Negative)
Gene Accession No.
O95243
Gene Symbols
MBD4
Immunogen
A synthetic peptide made to an internal portion of the human MBD4 protein (between residues 200-250) [UniProt O95243]
Quantity
0.1 mL
Research Discipline
Base Excision Repair, Chromatin Research, DNA Repair, Epigenetics
Gene ID (Entrez)
8930
Target Species
Human, Mouse (Negative)
Isotype
IgG
Applications
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Western Blot
Conjugate
Alexa Fluor 700
Formulation
50mM Sodium Borate with 0.05% Sodium Azide
Gene Alias
EC 3.2.2.-, G/T mismatch glycosylase, G/U mismatch glycosylase, MED1G/5-fluorouracil mismatch glycosylase with biphasic kinetics, methyl-CpG binding domain protein 4, methyl-CpG-binding domain protein 43,N(4)-ethenocytosine glycosylase, Methyl-CpG-binding endonuclease 1, Methyl-CpG-binding protein MBD4, Mismatch-specific DNA N-glycosylase, putative methyl-CpG binding protein
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Human. Does not react with mouse.
Content And Storage
Store at 4C in the dark.
Related Products
Description
- MBD4 Polyclonal specifically detects MBD4 in Human, Mouse (Negative) samples
- It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Western Blot (Negative).
Compare Similar Items
Show Difference
Antigen: MBD4
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Western Blot (Negative)
Gene Accession No.: O95243
Gene Symbols: MBD4
Immunogen: A synthetic peptide made to an internal portion of the human MBD4 protein (between residues 200-250) [UniProt O95243]
Quantity: 0.1 mL
Research Discipline: Base Excision Repair, Chromatin Research, DNA Repair, Epigenetics
Gene ID (Entrez): 8930
Target Species: Human, Mouse (Negative)
Isotype: IgG
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Western Blot
Conjugate: Alexa Fluor 700
Formulation: 50mM Sodium Borate with 0.05% Sodium Azide
Gene Alias: EC 3.2.2.-, G/T mismatch glycosylase, G/U mismatch glycosylase, MED1G/5-fluorouracil mismatch glycosylase with biphasic kinetics, methyl-CpG binding domain protein 4, methyl-CpG-binding domain protein 43,N(4)-ethenocytosine glycosylase, Methyl-CpG-binding endonuclease 1, Methyl-CpG-binding protein MBD4, Mismatch-specific DNA N-glycosylase, putative methyl-CpG binding protein
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Human. Does not react with mouse.
Content And Storage: Store at 4C in the dark.
Antigen: Glycogen synthase 2
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Accession No.: __
Gene Symbols: GYS2
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:VPPSPSGSQASSPQSSDVEDEVEDERYDEEEEAERDRLNIKSPFSLSHVPHGKKKLHGEYKN
Quantity: 0.1 mL
Research Discipline: __
Gene ID (Entrez): 2998
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: EC 2.4.1.11, glycogen [starch] synthase, liver, glycogen synthase 2 (liver)
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of human Glycogen synthase 2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: VPPSPSGSQASSPQSSDVEDEVEDERYDEEEEAERDRLNIKSPFSLSHVPHGKKKLHGEYKN
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 2998
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.