ZSCAN5B Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP191411-Each-of-1 | In Stock | ₹ 41,710.50 |
NBP191411 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
Antigen
ZSCAN5B
Classification
Polyclonal
Conjugate
Unconjugated
Formulation
PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Symbols
ZSCAN5B
Immunogen
Synthetic peptide directed towards the C terminal of human hCG_2042202. Peptide sequence HKRIHTGERPFKCKYCSKVFSHKGNLNVHQRTHSGEKPYKCPTCQKAFRQ.
Purification Method
Affinity purified
Regulatory Status
RUO
Gene ID (Entrez)
342933
Reconstitution
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications
Western Blot
Concentration
0.5 mg/ml
Dilution
Western Blot 1.0 ug/ml
Gene Alias
zinc finger and SCAN domain containing 5B, zinc finger and SCAN domain-containing protein 5B, ZNF495B
Host Species
Rabbit
Molecular Weight of Antigen
50 kDa
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Expected identity based on immunogen sequence: Human: 100;%Mouse: 100%; Rat: 100%; Bovine: 92%; Florida lancelet: 92%; Short-tailed field vole: 92%; Crab-eating macaque: 92%; Sumatran orangutan: 92%; Xenopus: 91%; Western clawed frog: 91%; Zebrafish: 91%; Green puffer: 91%; Rainbow smelt: 91%; Chicken: 91%;Onchocerca volvulus: 85%; Canine: 84%; Fruit fly: 84%; Bornean orangutan: 84%; Chimpanzee: 84%; Pig-tailed macaque: 84%; Red-chested mustached tamarin: 84%; Western Gorilla: 84%; Common woolly monkey: 84%.
Target Species
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Isotype
IgG
Description
- ZSCAN5B Polyclonal specifically detects ZSCAN5B in Human samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: ZSCAN5B
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Symbols: ZSCAN5B
Immunogen: Synthetic peptide directed towards the C terminal of human hCG_2042202. Peptide sequence HKRIHTGERPFKCKYCSKVFSHKGNLNVHQRTHSGEKPYKCPTCQKAFRQ.
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 342933
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Alias: zinc finger and SCAN domain containing 5B, zinc finger and SCAN domain-containing protein 5B, ZNF495B
Host Species: Rabbit
Molecular Weight of Antigen: 50 kDa
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Human: 100;%Mouse: 100%; Rat: 100%; Bovine: 92%; Florida lancelet: 92%; Short-tailed field vole: 92%; Crab-eating macaque: 92%; Sumatran orangutan: 92%; Xenopus: 91%; Western clawed frog: 91%; Zebrafish: 91%; Green puffer: 91%; Rainbow smelt: 91%; Chicken: 91%;Onchocerca volvulus: 85%; Canine: 84%; Fruit fly: 84%; Bornean orangutan: 84%; Chimpanzee: 84%; Pig-tailed macaque: 84%; Red-chested mustached tamarin: 84%; Western Gorilla: 84%; Common woolly monkey: 84%.
Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Isotype: IgG
Antigen: MSL3P1
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Symbols: MSL3L2
Immunogen: Synthetic peptide directed towards the middle region of human MSL3L2. Peptide sequence EKLSPSLRLLNPSRPQSTESQSTSGEPATPKRRKAEPQAVQSLRRSSPHT.
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 151507
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Alias: MSL3L2, MSL3P1 male-specific lethal 3 homolog (Drosophila) pseudogene 1
Host Species: Rabbit
Molecular Weight of Antigen: 51 kDa
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Bovine: 91%; White-tufted-ear marmoset: 83%; Canine: 83%; Sumatran orangutan: 83%; Human: 100%.
Target Species: Human, Rat, Bovine, Canine, Guinea Pig
Isotype: IgG
Antigen: ZNF192P1
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Symbols: ZNF389
Immunogen: Synthetic peptide directed towards the N terminal of human ZNF389. Peptide sequence MDPHQKVPSIYNGDTLQTPEYEKVSQYEDQLERHEGRHMEERRYKCNECG.
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 651302
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
Applications: Western Blot
Concentration: __
Dilution: Western Blot 1.0 ug/ml
Gene Alias: dJ265C24.4, ZNF192P1 zinc finger protein 192 pseudogene 1, ZNF389, ZNF389P
Host Species: Rabbit
Molecular Weight of Antigen: 31 kDa
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Pig: 92% Bovine 82%.
Target Species: Human, Porcine, Bovine
Isotype: IgG
