NLRP3/NALP3 Antibody (Nalpy3-b) - BSA Free, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP191567-Each-of-1 | In Stock | ₹ 39,699.84 |
NBP191567 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 39,699.84
GST (18%): ₹ 7,145.971
Total Price: ₹ 46,845.811
Antigen
LOC342293
Classification
Polyclonal
Dilution
Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Gene Alias
LOC342293 ATP-binding cassette, sub-family A (ABC1), member 3 pseudogene
Host Species
Rabbit
Purification Method
Protein A purified
Regulatory Status
RUO
Gene ID (Entrez)
342293
Reconstitution
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage
Store at -20C. Avoid freeze-thaw cycles.
Isotype
IgG
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Symbols
LOC342293
Immunogen
Synthetic peptide directed towards the N terminal of human LOC342293. Peptide sequence PQIGLYVNKCLNSLELESHAARLINTYSEGNKRRLSTAIALMGRSSVIFL.
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Expected identity based on immunogen sequence: Mouse: 100%; Crab-eating macaque: 100%;Caenorhabditis briggsae: 90%;Caenorhabditis vulgaris: 90%;Caenorhabditis elegans: 90%; Olive fruit fly: 84%; Bovine: 84%; Yellowfever mosquito: 84%;Tetrahymena thermophilaSB210: 84%; Green puffer: 84%; Western clawed frog: 84%; Purple sea urchin: 84%; Canine: 84%; Chicken: 84%; Rat: 84%; Florida lancelet: 84%; Black-legged tick: 84%; Human: 100%; Trichoplax reptans: 84%; Choanoflagellate: 84%; Starlet sea anemone: 84%; Zebrafish: 84%.
Target Species
Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Form
Purified
Related Products
Description
- LOC342293 Polyclonal specifically detects LOC342293 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: LOC342293
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Gene Alias: LOC342293 ATP-binding cassette, sub-family A (ABC1), member 3 pseudogene
Host Species: Rabbit
Purification Method: Protein A purified
Regulatory Status: RUO
Gene ID (Entrez): 342293
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Symbols: LOC342293
Immunogen: Synthetic peptide directed towards the N terminal of human LOC342293. Peptide sequence PQIGLYVNKCLNSLELESHAARLINTYSEGNKRRLSTAIALMGRSSVIFL.
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Mouse: 100%; Crab-eating macaque: 100%;Caenorhabditis briggsae: 90%;Caenorhabditis vulgaris: 90%;Caenorhabditis elegans: 90%; Olive fruit fly: 84%; Bovine: 84%; Yellowfever mosquito: 84%;Tetrahymena thermophilaSB210: 84%; Green puffer: 84%; Western clawed frog: 84%; Purple sea urchin: 84%; Canine: 84%; Chicken: 84%; Rat: 84%; Florida lancelet: 84%; Black-legged tick: 84%; Human: 100%; Trichoplax reptans: 84%; Choanoflagellate: 84%; Starlet sea anemone: 84%; Zebrafish: 84%.
Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Form: Purified
Antigen: __
Classification: __
Dilution: __
Gene Alias: member 10, solute carrier family 22, member 10
Host Species: __
Purification Method: __
Regulatory Status: RUO - research use only
Gene ID (Entrez): 387775
Reconstitution: __
Content And Storage: Store at -20 C. Avoid freeze-thaw cycles.
Isotype: __
Applications: __
Conjugate: __
Formulation: Lyophilized with sterile distilled water.
Gene Symbols: __
Immunogen: __
Quantity: 100 μg
Primary or Secondary: __
Test Specificity: __
Target Species: __
Form: __
Antigen: SLC25A37
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Alias: PRO1278, solute carrier family 25, member 37
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 51312
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype: IgG
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Symbols: SLC25A37
Immunogen: Synthetic peptide directed towards the middle region of human SLC25A37. Peptide sequence RTVYQLNGLAGYFKGIQARVIYQMPSTAISWSVYEFFKYFLTKRQLENRA.
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Guinea pig: 100%; Mouse: 100%; Rabbit: 92%; Bovine: 85%.
Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Form: __