Cytochrome P450 2D6 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP191818-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP191818 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
Cytochrome P450 2D6
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias
CPD6P450DB1, CYP2D, CYP2D7AP, CYP2D7BP, CYP2D7P2, CYP2D8P2, CYP2DL1, CYPIID6, cytochrome P450 2D6, cytochrome P450, family 2, subfamily D, polypeptide 6, cytochrome P450, family 2, subfamily D, polypeptide 7 pseudogene 2, cytochrome P450, family 2, subfamily D, polypeptide 8 pseudogene 2, cytochrome P450, subfamily II (debrisoquine, sparteine, etc., -metabolising), cytochrome P450, subfamily IID (debrisoquine, sparteine, etc., cytochrome P450, subfamily IID (debrisoquine, sparteine, etc., -metabolising), cytochrome P450, subfamily IID (debrisoquine, sparteine, etc., -metabolizing), Cytochrome P450-DB1, Debrisoquine 4-hydroxylase, EC 1.14.14.1, flavoprotein-linked monooxygenase, -metabolizing)-like 1, MGC120389, MGC120390, microsomal monooxygenase, P450C2D, P450-DB1, polypeptide 6, polypeptide 7 pseudogene 2, polypeptide 8 pseudogene 2, xenobiotic monooxygenase
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
1565
Target Species
Human
Isotype
IgG
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols
CYP2D6
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EYDDPRFLRLLDLAQEGLKEESGFLREVLNAVPVLLHIPALAGKVLRFQKAFLTQLDELLTEHRMTWDPAQPPRDLTE
Quantity
0.1 mL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Description
- Cytochrome P450 2D6 Polyclonal specifically detects Cytochrome P450 2D6 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: Cytochrome P450 2D6
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias: CPD6P450DB1, CYP2D, CYP2D7AP, CYP2D7BP, CYP2D7P2, CYP2D8P2, CYP2DL1, CYPIID6, cytochrome P450 2D6, cytochrome P450, family 2, subfamily D, polypeptide 6, cytochrome P450, family 2, subfamily D, polypeptide 7 pseudogene 2, cytochrome P450, family 2, subfamily D, polypeptide 8 pseudogene 2, cytochrome P450, subfamily II (debrisoquine, sparteine, etc., -metabolising), cytochrome P450, subfamily IID (debrisoquine, sparteine, etc., cytochrome P450, subfamily IID (debrisoquine, sparteine, etc., -metabolising), cytochrome P450, subfamily IID (debrisoquine, sparteine, etc., -metabolizing), Cytochrome P450-DB1, Debrisoquine 4-hydroxylase, EC 1.14.14.1, flavoprotein-linked monooxygenase, -metabolizing)-like 1, MGC120389, MGC120390, microsomal monooxygenase, P450C2D, P450-DB1, polypeptide 6, polypeptide 7 pseudogene 2, polypeptide 8 pseudogene 2, xenobiotic monooxygenase
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 1565
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: CYP2D6
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:EYDDPRFLRLLDLAQEGLKEESGFLREVLNAVPVLLHIPALAGKVLRFQKAFLTQLDELLTEHRMTWDPAQPPRDLTE
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: DCAF4
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias: DDB1 and CUL4 associated factor 4, DDB1- and CUL4-associated factor 4, DKFZp434K114, MGC20547, MGC46524, WD repeat domain 21, WD repeat domain 21A, WD repeat-containing protein 21A, WDR21, WDR21A
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 26094
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: DCAF4
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:TSSGTAGTSSVPELPGFYFDPEKKRYFRLLPGHNNCNPLTKESIRQKEMESKRLRLLQEEDRRK
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Gene ID (Entrez): 1632
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: HYAGYWKAVQELWLRLYQSNLVLVSAINGACPAGGCLVALTCDYRILADNPRYCIGLNETQLGIIAPFWLKDTLENTIGH
Quantity: 0.1mL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.