HM74A/PUMA-G/GPR109A/NIACR1 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP192180-Each-of-1 | In Stock | ₹ 54,245.04 |
NBP192180 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 54,245.04
GST (18%): ₹ 9,764.107
Total Price: ₹ 64,009.147
Antigen
HM74A/PUMA-G/GPR109A/NIACR1
Classification
Polyclonal
Dilution
Western Blot Reported in scientific literature (PMID 25622782)., Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200, Knockdown Validated Reported in scientific publication (PMID: 32397071).
Gene Accession No.
Q8TDS4
Gene Symbols
HCAR2
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NRCLQRKMTGEPDNNRSTSVELTGDPNKTRGAPEALMANSGEPWSPSYLGP
Quantity
0.1 mL
Primary or Secondary
Primary
Test Specificity
Specificity of human HM74A/PUMA-G/GPR109A/NIACR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
GPR109A, HCA2, hydroxycarboxylic acid receptor 2, NIACR1
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
338442
Target Species
Human, Mouse, Rat
Isotype
IgG
Related Products
Description
- HM74A/PUMA-G/GPR109A/NIACR1 Polyclonal specifically detects HM74A/PUMA-G/GPR109A/NIACR1 in Human, Mouse, Rat, Bovine samples
- It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.
Compare Similar Items
Show Difference
Antigen: HM74A/PUMA-G/GPR109A/NIACR1
Classification: Polyclonal
Dilution: Western Blot Reported in scientific literature (PMID 25622782)., Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200, Knockdown Validated Reported in scientific publication (PMID: 32397071).
Gene Accession No.: Q8TDS4
Gene Symbols: HCAR2
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:NRCLQRKMTGEPDNNRSTSVELTGDPNKTRGAPEALMANSGEPWSPSYLGP
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of human HM74A/PUMA-G/GPR109A/NIACR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: GPR109A, HCA2, hydroxycarboxylic acid receptor 2, NIACR1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 338442
Target Species: Human, Mouse, Rat
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: NRCLQRKMTGEPDNNRSTSVELTGDPNKTRGAPEALMANSGEPWSPSYLGP
Quantity: 0.1mL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Gene ID (Entrez): 338442
Target Species: __
Isotype: __
Antigen: Ninjurin-1
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Accession No.: __
Gene Symbols: NINJ1
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:IFLVKYDLNNPAKHAKLDFLNN
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: Nerve injury-induced protein 1, nerve injury-induced protein-1, NIN1, NINJURIN, ninjurin 1, ninjurin-1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 4814
Target Species: Human
Isotype: IgG