NME5 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP192188-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP192188 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
NME5
Classification
Polyclonal
Dilution
Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Gene Alias
Inhibitor of p53-induced apoptosis-beta, IPIA-beta, NDK-H 5, NDP kinase homolog 5, nm23-H5, NM23H5, non-metastatic cells 5, protein expressed in (nucleoside-diphosphate kinase), nucleoside diphosphate kinase homolog 5, radial spoke 23 homolog, RSPH23, Testis-specific nm23 homolog
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols
NME5
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FMFPEVIVEPIPIGQAAKDYLNLHIMPTLLEGLTELCKQKPADPLIWLADWLLKNNPNKPKLCHHPI
Quantity
0.1 mL
Research Discipline
Apoptosis
Gene ID (Entrez)
8382
Target Species
Human
Isotype
IgG
Related Products
Description
- NME5 Polyclonal specifically detects NME5 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: NME5
Classification: Polyclonal
Dilution: Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Gene Alias: Inhibitor of p53-induced apoptosis-beta, IPIA-beta, NDK-H 5, NDP kinase homolog 5, nm23-H5, NM23H5, non-metastatic cells 5, protein expressed in (nucleoside-diphosphate kinase), nucleoside diphosphate kinase homolog 5, radial spoke 23 homolog, RSPH23, Testis-specific nm23 homolog
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: NME5
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:FMFPEVIVEPIPIGQAAKDYLNLHIMPTLLEGLTELCKQKPADPLIWLADWLLKNNPNKPKLCHHPI
Quantity: 0.1 mL
Research Discipline: Apoptosis
Gene ID (Entrez): 8382
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: FMFPEVIVEPIPIGQAAKDYLNLHIMPTLLEGLTELCKQKPADPLIWLADWLLKNNPNKPKLCHHPI
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 8382
Target Species: __
Isotype: __
Antigen: NOC2L
Classification: Polyclonal
Dilution: Western Blot 0.04 to 0.4 μg/mL, Simple Western, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500, KnockDown Validated
Gene Alias: DKFZP564C186, FLJ35172, NET15, NET7, NIR, NOC2-like protein, novel INHAT (inhibitor of histone acetyltransferase) repressor, nucleolar complex associated 2 homolog (S. cerevisiae), nucleolar complex protein 2 homolog, Protein NOC2 homolog
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: NOC2L
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:LTVDEFLASGFDSESESESENSPQAETREAREAARSPDKPGGSPSASRRKGRASEHKDQLSRLKDRDPEFYKFLQENDQSLLNFSDS
Quantity: 0.1 mL
Research Discipline: __
Gene ID (Entrez): 26155
Target Species: Human
Isotype: IgG