OPA3 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP192221-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP192221 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
OPA3
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Accession No.
Q9H6K4
Gene Symbols
OPA3
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RHQLQQRRKEKERRVAREALRGEVGHLGLALEELQAQVQATSTQLALEELRAQLQEVRAHLCLRDP
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
FLJ22187, FLJ25932, MGA3Optic atrophy 3 (Iraqi-Jewish 'optic atrophy plus'), MGC75494, optic atrophy 3 (autosomal recessive, with chorea and spastic paraplegia), optic atrophy 3 protein
Host Species
Rabbit
Molecular Weight of Antigen
20 kDa
Quantity
0.1 mL
Research Discipline
Vision
Gene ID (Entrez)
80207
Target Species
Human
Isotype
IgG
Related Products
Description
- OPA3 Polyclonal specifically detects OPA3 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: OPA3
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Accession No.: Q9H6K4
Gene Symbols: OPA3
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:RHQLQQRRKEKERRVAREALRGEVGHLGLALEELQAQVQATSTQLALEELRAQLQEVRAHLCLRDP
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: FLJ22187, FLJ25932, MGA3Optic atrophy 3 (Iraqi-Jewish 'optic atrophy plus'), MGC75494, optic atrophy 3 (autosomal recessive, with chorea and spastic paraplegia), optic atrophy 3 protein
Host Species: Rabbit
Molecular Weight of Antigen: 20 kDa
Quantity: 0.1 mL
Research Discipline: Vision
Gene ID (Entrez): 80207
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: RHQLQQRRKEKERRVAREALRGEVGHLGLALEELQAQVQATSTQLALEELRAQLQEVRAHLCLRDP
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Molecular Weight of Antigen: __
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 80207
Target Species: __
Isotype: __
Antigen: OR10J3
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Accession No.: __
Gene Symbols: OR10J3
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:LKPKSQSSLGQDRLISVTYTHHSPTEPCCVQPEEQGGQRCSAQSRGAKNSVSLMKRGCEGFSFAFINMY
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: olfactory receptor 10J3, olfactory receptor OR1-25 pseudogene, olfactory receptor, family 10, subfamily J, member 3, olfactory receptor, family 10, subfamily J, member 3 pseudogene, OR10J3P, OR1-25
Host Species: Rabbit
Molecular Weight of Antigen: __
Quantity: 0.1 mL
Research Discipline: __
Gene ID (Entrez): 441911
Target Species: Human
Isotype: IgG