NG2/MCSP Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP194154-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP194154 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
NG2/MCSP
Classification
Polyclonal
Dilution
Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias
chondroitin sulfate proteoglycan 4, chondroitin sulfate proteoglycan 4 (melanoma-associated), EC 3.6.3, HMW-MAA, MCSPChondroitin sulfate proteoglycan NG2, MCSPGMelanoma chondroitin sulfate proteoglycan, MEL-CSPG, MSK16Melanoma-associated chondroitin sulfate proteoglycan, NG2EC 2.7.8
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols
CSPG4
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LEPLHTQNTQQEALTTAHLEATLEEAGPS
Quantity
0.1 mL
Research Discipline
Cancer, Neuroscience
Gene ID (Entrez)
1464
Target Species
Human
Isotype
IgG
Related Products
Description
- NG2/MCSP Polyclonal specifically detects NG2/MCSP in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: NG2/MCSP
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias: chondroitin sulfate proteoglycan 4, chondroitin sulfate proteoglycan 4 (melanoma-associated), EC 3.6.3, HMW-MAA, MCSPChondroitin sulfate proteoglycan NG2, MCSPGMelanoma chondroitin sulfate proteoglycan, MEL-CSPG, MSK16Melanoma-associated chondroitin sulfate proteoglycan, NG2EC 2.7.8
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: CSPG4
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:LEPLHTQNTQQEALTTAHLEATLEEAGPS
Quantity: 0.1 mL
Research Discipline: Cancer, Neuroscience
Gene ID (Entrez): 1464
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: LEPLHTQNTQQEALTTAHLEATLEEAGPS
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 1464
Target Species: __
Isotype: __
Antigen: C17orf67
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Alias: chromosome 17 open reading frame 67, hypothetical protein LOC339210
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: C17orf67
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:TEKQAKQLLRSRRQDRPSKPGFPDEPMREYMHHLLALEHRAEEQFLEHWLNPHCKPHCDRNRIHPV
Quantity: 0.1 mL
Research Discipline: __
Gene ID (Entrez): 339210
Target Species: Human
Isotype: IgG