TMEFF1/Tomoregulin-1 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP213441-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP213441 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
TMEFF1/Tomoregulin-1
Classification
Polyclonal
Dilution
Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias
C9orf2, H7365member 1, tomoregulin-1, TR-1, Transmembrane protein with EGF-like and one follistatin-like domain, transmembrane protein with EGF-like and two follistatin-like domains 1
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols
TMEFF1
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DCPGGKGKSINCSELNVRES
Quantity
0.1 mL
Research Discipline
Core ESC Like Genes, Stem Cell Markers
Gene ID (Entrez)
8577
Target Species
Human
Isotype
IgG
Related Products
Description
- TMEFF1/Tomoregulin-1 Polyclonal specifically detects TMEFF1/Tomoregulin-1 in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: TMEFF1/Tomoregulin-1
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias: C9orf2, H7365member 1, tomoregulin-1, TR-1, Transmembrane protein with EGF-like and one follistatin-like domain, transmembrane protein with EGF-like and two follistatin-like domains 1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: TMEFF1
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DCPGGKGKSINCSELNVRES
Quantity: 0.1 mL
Research Discipline: Core ESC Like Genes, Stem Cell Markers
Gene ID (Entrez): 8577
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: DCPGGKGKSINCSELNVRES
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 8577
Target Species: __
Isotype: __
Antigen: TMEM106C
Classification: Polyclonal
Dilution: Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Alias: EMOC, Endoplasmic reticulum membrane protein overexpressed in cancer, MGC111210, MGC5576, transmembrane protein 106C
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: TMEM106C
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SVKISYIGLMTQSSLETHHYVDCGGNSTAI
Quantity: 0.1 mL
Research Discipline: __
Gene ID (Entrez): 79022
Target Species: Human
Isotype: IgG