TRA2A Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP213473-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP213473 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
TRA2A
Classification
Polyclonal
Dilution
Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20-1:50
Gene Alias
HSU53209, htra-2 alpha, htra-2-alpha, putative MAPK activating protein PM24, TRA-2 alpha, tra2a, Tra2alpha, TRA2-alpha, transformer 2 alpha homolog (Drosophila), transformer-2 alpha, Transformer-2 protein homolog A, transformer-2 protein homolog alpha
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols
TRA2A
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SDVEENNFEGRESRSQSKSPTGTPARVKSESRSGSR
Quantity
0.1 mL
Research Discipline
Cancer, GPCR, Neuroscience
Gene ID (Entrez)
29896
Target Species
Human
Isotype
IgG
Related Products
Description
- TRA2A Polyclonal specifically detects TRA2A in Human samples
- It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: TRA2A
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20-1:50
Gene Alias: HSU53209, htra-2 alpha, htra-2-alpha, putative MAPK activating protein PM24, TRA-2 alpha, tra2a, Tra2alpha, TRA2-alpha, transformer 2 alpha homolog (Drosophila), transformer-2 alpha, Transformer-2 protein homolog A, transformer-2 protein homolog alpha
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: TRA2A
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SDVEENNFEGRESRSQSKSPTGTPARVKSESRSGSR
Quantity: 0.1 mL
Research Discipline: Cancer, GPCR, Neuroscience
Gene ID (Entrez): 29896
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: SDVEENNFEGRESRSQSKSPTGTPARVKSESRSGSR
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 29896
Target Species: __
Isotype: __
Antigen: TRAPPC4
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias: Hematopoietic stem/progenitor cell protein 172, PTD009, SBDNHSPC172, Synbindin, trafficking protein particle complex 4, trafficking protein particle complex subunit 4, TRS23, TRS23 homolog
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: TRAPPC4
Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: HCYQTLTGIKFVVLADPRQAGIDSLLRKIYEIYSDFALKNPFYSLEMPIRCELFDQNLKLALEVAEKAGT
Quantity: 0.1 mL
Research Discipline: __
Gene ID (Entrez): 51399
Target Species: Human, Mouse, Rat
Isotype: IgG