TXNDC5 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP213496-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP213496 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
TXNDC5
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000
Gene Alias
ENDOPDI, ERP46, FLJ90810, HCC-2, member 15, MGC3178, PDIA15, thioredoxin domain containing 5, thioredoxin domain containing 5 (endoplasmic reticulum), thioredoxin domain-containing protein 5, thioredoxin related protein, TLP46
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols
TXNDC5
Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: TLENWMLQTLNEEPVTPEPEVEPPSAPELKQGLYELSASNFELHVAQGDHFIKFFAPWCGHCKALAPTWEQLALGLEHSETVKIGKVDC
Quantity
0.1 mL
Research Discipline
Apoptosis
Gene ID (Entrez)
81567
Target Species
Human
Isotype
IgG
Related Products
Description
- TXNDC5 Polyclonal specifically detects TXNDC5 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: TXNDC5
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000
Gene Alias: ENDOPDI, ERP46, FLJ90810, HCC-2, member 15, MGC3178, PDIA15, thioredoxin domain containing 5, thioredoxin domain containing 5 (endoplasmic reticulum), thioredoxin domain-containing protein 5, thioredoxin related protein, TLP46
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: TXNDC5
Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: TLENWMLQTLNEEPVTPEPEVEPPSAPELKQGLYELSASNFELHVAQGDHFIKFFAPWCGHCKALAPTWEQLALGLEHSETVKIGKVDC
Quantity: 0.1 mL
Research Discipline: Apoptosis
Gene ID (Entrez): 81567
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: MTELQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYE
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 7326
Target Species: __
Isotype: __
Antigen: UBE2G1
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:20-1:50
Gene Alias: EC 6.3.2.19, UBC7, UBE2GE217K, Ubiquitin carrier protein G1, ubiquitin-conjugating enzyme E2 G1, ubiquitin-conjugating enzyme E2G 1 (homologous to C. elegans UBC7), ubiquitin-conjugating enzyme E2G 1 (UBC7 homolog, C. elegans), ubiquitin-conjugating enzyme E2G 1 (UBC7 homolog, yeast), Ubiquitin-protein ligase G1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: UBE2G1
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVA
Quantity: 0.1 mL
Research Discipline: Core ESC Like Genes, Stem Cell Markers
Gene ID (Entrez): 7326
Target Species: Human
Isotype: IgG