ZDHHC1 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP213539-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP213539 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
ZDHHC1
Classification
Polyclonal
Dilution
Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias
C16orf1, DHHC domain-containing cysteine-rich protein 1, DHHC-1, DHHC-domain-containing cysteine-rich protein, EC 2.3.1.-, HSU90653, probable palmitoyltransferase ZDHHC1, Zinc finger DHHC domain-containing protein 1, Zinc finger protein 377, zinc finger, DHHC domain containing 1, zinc finger, DHHC-type containing 1, ZNF377chromosome 16 open reading frame 1
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
29800
Target Species
Human
Isotype
IgG
Applications
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols
ZDHHC1
Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: HKLTTYEYIVQHRPPQEAKGVHRELESCPPKMRPIQEMEFYMRTFRHMRPEPPGQAGPAAVNAKHSRPASPDPTPGRRDCAGPPVQVEWD
Quantity
0.1 mL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- ZDHHC1 Polyclonal specifically detects ZDHHC1 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.
Compare Similar Items
Show Difference
Antigen: ZDHHC1
Classification: Polyclonal
Dilution: Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias: C16orf1, DHHC domain-containing cysteine-rich protein 1, DHHC-1, DHHC-domain-containing cysteine-rich protein, EC 2.3.1.-, HSU90653, probable palmitoyltransferase ZDHHC1, Zinc finger DHHC domain-containing protein 1, Zinc finger protein 377, zinc finger, DHHC domain containing 1, zinc finger, DHHC-type containing 1, ZNF377chromosome 16 open reading frame 1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 29800
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: ZDHHC1
Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: HKLTTYEYIVQHRPPQEAKGVHRELESCPPKMRPIQEMEFYMRTFRHMRPEPPGQAGPAAVNAKHSRPASPDPTPGRRDCAGPPVQVEWD
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: ZDHHC2
Classification: Polyclonal
Dilution: Western Blot Reactivity reported in (PMID: 26214373)., Simple Western 1:20, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias: DHHC2, DHHC-2, EC 2.3.1, EC 2.3.1.-, palmitoyltransferase ZDHHC2, Ream, REC, Reduced expression associated with metastasis protein, Reduced expression in cancer protein, Zinc finger DHHC domain-containing protein 2, Zinc finger protein 372, zinc finger, DHHC domain containing 2, zinc finger, DHHC-type containing 2, ZNF372rec
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 51201
Target Species: Human, Mouse
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: ZDHHC2
Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: KEFHLSYAEKDLLEREPRGEAHQEVLRRAAKDLPIYTRTMSGAIRYCDRCQLI
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of human ZDHHC2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Gene ID (Entrez): 51201
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: KEFHLSYAEKDLLEREPRGEAHQEVLRRAAKDLPIYTRTMSGAIRYCDRCQLI
Quantity: 0.1mL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.