NHP2 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP213656-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP213656 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
NHP2
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50-1:200
Gene Alias
FLJ20479, H/ACA ribonucleoprotein complex subunit 2, NHP2 ribonucleoprotein homolog (yeast), NHP2-like protein, NHP2P, NOLA2member 2 (H/ACA small nucleolar RNPs), Nucleolar protein family A member 2, snoRNP protein NHP2
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols
NHP2
Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: LAGDTLPIEVYCHLPVMCEDRNLPYVYIPSKTDLGAAAGSKRPTCVIMVKPHEEYQEAYDECLEEVQSLP
Quantity
0.1 mL
Research Discipline
Core ESC Like Genes, Stem Cell Markers
Gene ID (Entrez)
55651
Target Species
Human, Mouse
Isotype
IgG
Related Products
Description
- NHP2 Polyclonal specifically detects NHP2 in Human, Mouse samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: NHP2
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50-1:200
Gene Alias: FLJ20479, H/ACA ribonucleoprotein complex subunit 2, NHP2 ribonucleoprotein homolog (yeast), NHP2-like protein, NHP2P, NOLA2member 2 (H/ACA small nucleolar RNPs), Nucleolar protein family A member 2, snoRNP protein NHP2
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: NHP2
Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: LAGDTLPIEVYCHLPVMCEDRNLPYVYIPSKTDLGAAAGSKRPTCVIMVKPHEEYQEAYDECLEEVQSLP
Quantity: 0.1 mL
Research Discipline: Core ESC Like Genes, Stem Cell Markers
Gene ID (Entrez): 55651
Target Species: Human, Mouse
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: LAGDTLPIEVYCHLPVMCEDRNLPYVYIPSKTDLGAAAGSKRPTCVIMVKPHEEYQEAYDECLEEVQSLP
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 55651
Target Species: __
Isotype: __
Antigen: NKD2
Classification: Polyclonal
Dilution: Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Alias: Dvl-binding protein NKD2, hNkd2, naked cuticle homolog 2 (Drosophila), naked cuticle-2, Naked2, Naked-2, protein naked cuticle homolog 2
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: NKD2
Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: GHKRYRQKGREGHSPLKAPHAQPATVEHEVVRDLPPTPAGEGYAVPVIQRHE
Quantity: 0.1 mL
Research Discipline: Wnt Signaling Pathway
Gene ID (Entrez): 85409
Target Species: Human
Isotype: IgG