CNOT8 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP213849-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP213849 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
CNOT8
Classification
Polyclonal
Dilution
Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Alias
CAF1, CAF2, CALIFCAF1-like protein, CALIFp, CCR4-NOT transcription complex subunit 8, CCR4-NOT transcription complex, subunit 8, hCAF1, PGK promoter directed over production, POP2CCR4-associated factor 8
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols
CNOT8
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: CGRLYGLGTGVAQKQNEDVDSAQEKMSILAIINNMQQ
Quantity
0.1 mL
Research Discipline
DNA replication Transcription Translation and Splicing
Gene ID (Entrez)
9337
Target Species
Human
Isotype
IgG
Related Products
Description
- CNOT8 Polyclonal specifically detects CNOT8 in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: CNOT8
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Alias: CAF1, CAF2, CALIFCAF1-like protein, CALIFp, CCR4-NOT transcription complex subunit 8, CCR4-NOT transcription complex, subunit 8, hCAF1, PGK promoter directed over production, POP2CCR4-associated factor 8
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: CNOT8
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: CGRLYGLGTGVAQKQNEDVDSAQEKMSILAIINNMQQ
Quantity: 0.1 mL
Research Discipline: DNA replication Transcription Translation and Splicing
Gene ID (Entrez): 9337
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: CGRLYGLGTGVAQKQNEDVDSAQEKMSILAIINNMQQ
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 9337
Target Species: __
Isotype: __
Antigen: CNTD2
Classification: Polyclonal
Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias: cyclin N-terminal domain containing 2
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: CNTD2
Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: SRLGPIVRRWAPRPSPLQSLAASLDAEPSSAAVPDGFPAGPTVSPRRLARPPGLEEALSALGLQGEREYAGDIFAEVM
Quantity: 0.1 mL
Research Discipline: __
Gene ID (Entrez): 79935
Target Species: Human
Isotype: IgG